PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA22G00035
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family LBD
Protein Properties Length: 312aa    MW: 34449.5 Da    PI: 4.2655
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA22G00035genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.41.8e-4151041100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC+++Cv+apyfp +qp+kf +vh++FGasnv+k+l++lp+++re+a++sl+yeAear+rdP+yG+vg+i+ lqq  ++ +++l ++ke
  AA22G00035   5 PCAACKLLRRKCTQECVFAPYFPPTQPQKFIFVHRIFGASNVTKILNDLPHSQREEAVNSLYYEAEARLRDPIYGCVGLISFLQQCHKKIQQDLLSAKE 103
                 7********************************************************************************************998887 PP

      DUF260 100 e 100
                 e
  AA22G00035 104 E 104
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.3984105IPR004883Lateral organ boundaries, LOB
PfamPF031954.3E-405101IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MASTPCAACK LLRRKCTQEC VFAPYFPPTQ PQKFIFVHRI FGASNVTKIL NDLPHSQREE  60
AVNSLYYEAE ARLRDPIYGC VGLISFLQQC HKKIQQDLLS AKEELAGYMG SDSIIPYLPP  120
LTNPPPNFMM NMEGMITQGD SLIMSEPNSS HQLQLSQSQQ LQDSDQLQLS VADAQRMASM  180
ILERGDQGMF NGGYGIENNG SGKVTSTGYN QMDVNGGIHG PSLALGSYGN GYNQMSQEIV  240
ETQGQGQDQI SSDQLQTQLM LQPPLQEGQE QSDQGQFLMN SIGDCVAATE EDEEEEFAEP  300
PMKWRKSGEQ GS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4421088114LOB family transfactor Ramosa2.1
5ly0_B2e-4421088114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA22G00035
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002880519.11e-133LOB domain-containing protein 10
RefseqXP_020883060.11e-133LOB domain-containing protein 10
SwissprotO648361e-126LBD10_ARATH; LOB domain-containing protein 10
TrEMBLD7LG101e-132D7LG10_ARALL; LOB domain family protein
STRINGscaffold_400352.11e-133(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM149081720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23660.21e-105LOB domain-containing protein 10
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]