PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA21G00039
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family VOZ
Protein Properties Length: 496aa    MW: 55256.1 Da    PI: 4.8529
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA21G00039genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ4303.3e-1322254402217
         VOZ   2 ppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdlsl 100
                 ppsaflgpkcalwdctrpaqgs+w+ dycss+hatlalne++pgttpvlrp+gi+lkd+ll++al+ak+qgk+vgipecegaa++k+pwna+elf+l+l
  AA21G00039 225 PPSAFLGPKCALWDCTRPAQGSDWYPDYCSSYHATLALNEDTPGTTPVLRPGGISLKDNLLIDALRAKTQGKNVGIPECEGAANTKCPWNATELFHLEL 323
                 8************************************************************************************************** PP

         VOZ 101 legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgk 199
                 ++getirewlffdkprra++sgnrkqrslpdysgrgwhesrk +mke++g+krsyymdpqp++sfewhl+ey+ine+d +alyrlelkl+++kks+kgk
  AA21G00039 324 VDGETIREWLFFDKPRRAYDSGNRKQRSLPDYSGRGWHESRKLLMKEQEGQKRSYYMDPQPPGSFEWHLFEYQINECDGCALYRLELKLTNGKKSPKGK 422
                 *************************************************************************************************** PP

         VOZ 200 vskdsladlqkklgrlta 217
                 v+kd+ladlqkk+g+lta
  AA21G00039 423 VTKDPLADLQKKMGQLTA 440
                 ****************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MSNRRKTPCT SSAHQNLIDK LIDLQERFGH LQAARKDGRP GDQALLEAQI SQNLREWQAE  60
LSAPSPASSL LGESISHFSE EIARLMQLND EEDDASSSLK EHAAPKLEEF TQSLCPAEPV  120
DLTTDPFTQS PFNIDFSSGF EESINNTDTD DQQLHYAFQG FNQSINAAPD FQDTKLSDLD  180
ITSQLDYHLS EMRQELDYSP SIKLDASDEL NNYAELSTPS SIRTPPSAFL GPKCALWDCT  240
RPAQGSDWYP DYCSSYHATL ALNEDTPGTT PVLRPGGISL KDNLLIDALR AKTQGKNVGI  300
PECEGAANTK CPWNATELFH LELVDGETIR EWLFFDKPRR AYDSGNRKQR SLPDYSGRGW  360
HESRKLLMKE QEGQKRSYYM DPQPPGSFEW HLFEYQINEC DGCALYRLEL KLTNGKKSPK  420
GKVTKDPLAD LQKKMGQLTA EVASDKSSPS TKGRTKASKG EDTMTPRTTG PGSVPNGPSN  480
NSMGDHTNES PQARHQ
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ1 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Binds as a dimer to the palindromic sequence 5'-GCGTNNNNNNNACGC-3'. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00018PBMTransfer from AT2G42400Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA21G00039
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. Down-regulated by far-red light (at protein level). {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411498.10.0transcription factor VOZ2
RefseqXP_013687880.10.0transcription factor VOZ2
RefseqXP_013687881.10.0transcription factor VOZ2
RefseqXP_022557286.10.0transcription factor VOZ2
SwissprotQ9SLB90.0VOZ2_ARATH; Transcription factor VOZ2
TrEMBLA0A078FPJ90.0A0A078FPJ9_BRANA; BnaC04g48260D protein
TrEMBLA0A3P6CCF50.0A0A3P6CCF5_BRAOL; Uncharacterized protein
TrEMBLV4P0Z40.0V4P0Z4_EUTSA; Uncharacterized protein
STRINGXP_006411498.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM110602534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42400.10.0vascular plant one zinc finger protein 2
Publications ? help Back to Top
  1. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  2. Koguchi M,Yamasaki K,Hirano T,Sato MH
    Vascular plant one-zinc-finger protein 2 is localized both to the nucleus and stress granules under heat stress in Arabidopsis.
    Plant Signal Behav, 2017. 12(3): p. e1295907
    [PMID:28277968]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]