PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA19G00333
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family TALE
Protein Properties Length: 507aa    MW: 54595.6 Da    PI: 8.2991
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA19G00333genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33.1e-093043362254
                 SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 ++yp+ +++  LAk++gL+ +qV++WF N R +
  AA19G00333 304 HPYPTDTDKLMLAKQTGLSRNQVSNWFINARVR 336
                 89*****************************87 PP

2BELL110.69.1e-36154222472
        BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 e  kkk+kL+s+l+eV+krYkqy+eqlq v++sFe+vaglg+a+pY++lAlka+S+hF+cLk+ai++q+
  AA19G00333 154 ESGKKKSKLISMLDEVYKRYKQYYEQLQGVMGSFECVAGLGHAAPYATLALKALSKHFKCLKNAITDQL 222
                 6679**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.6E-6092220IPR006563POX domain
PfamPF075261.7E-3597219IPR006563POX domain
CDDcd000861.60E-11280341No hitNo description
SMARTSM003894.0E-9280344IPR001356Homeobox domain
SuperFamilySSF466896.84E-17282347IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-27284344IPR009057Homeodomain-like
PfamPF059201.5E-18297336IPR008422Homeobox KN domain
PROSITE profilePS5007111.645299340IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MGFLGPPSST SSTPVVTGDN NSFNAGTLSS GDVLVFKPEP LSLSLSSNPR LAYDLAVPSV  60
VNGNISRSNG DNSAAVTTVA VSRRSGPLGP FTGYASILKG SRFLKPAQLL LDEFCNVGRG  120
IYIENIDHDD DSSMLFDQTV ENLAASCGVS LGGESGKKKS KLISMLDEVY KRYKQYYEQL  180
QGVMGSFECV AGLGHAAPYA TLALKALSKH FKCLKNAITD QLQFNNHKNP QHSGHGGMSS  240
DKAESLRFGV SDEICRNSSR VLCSSAAPRH GFSDHHAPVW RPHRGLPERA VTVLRAWLFD  300
HFLHPYPTDT DKLMLAKQTG LSRNQVSNWF INARVRVWKP MVEEIHMLET RQAQRSISWR  360
DDRNSNVFSP DNPSSSAVQH QRGNNNDTSP QARRARNDDV QNNFGGPVNF SYGIGTANVP  420
VMSNSTNGGV SLTLGLHHQN NNGIGMPEPF QRFGLETGGS GGGGGGGECY GGGGGGGSGG  480
GYEGQNRQFG RDFIGSSNHQ FLHDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A4e-17286344159Homeobox protein Meis2
5bng_B4e-17286344159Homeobox protein Meis2
4xrm_B4e-17286344563Homeobox protein Meis2
4xrm_A4e-17286344563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006287258.10.0hypothetical protein CARUB_v10000448mg
SwissprotQ9LZM80.0BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLA0A078FED50.0A0A078FED5_BRANA; BnaCnng03740D protein
TrEMBLR0FE520.0R0FE52_9BRAS; Uncharacterized protein
STRINGBra009618.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56882746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.10.0TALE family protein