PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA197G00001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family TALE
Protein Properties Length: 326aa    MW: 37471.1 Da    PI: 6.9962
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA197G00001genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-092522872055
                  HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  AA197G00001 252 YKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 287
                  5679*****************************885 PP

2ELK36.21.3e-12207228122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK++Ll+KYsgyL+sLkqE+s
  AA197G00001 207 ELKNHLLKKYSGYLSSLKQELS 228
                  9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.0E-2267111IPR005540KNOX1
PfamPF037908.6E-2268109IPR005540KNOX1
SMARTSM012562.3E-30117168IPR005541KNOX2
PfamPF037917.5E-26121167IPR005541KNOX2
PROSITE profilePS5121311.243207227IPR005539ELK domain
PfamPF037896.2E-10207228IPR005539ELK domain
SMARTSM011881.0E-6207228IPR005539ELK domain
PROSITE profilePS5007113.021227290IPR001356Homeobox domain
SuperFamilySSF466891.63E-19228301IPR009057Homeodomain-like
SMARTSM003894.0E-13229294IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-27232293IPR009057Homeodomain-like
CDDcd000861.43E-11239291No hitNo description
PfamPF059208.9E-17247286IPR008422Homeobox KN domain
PROSITE patternPS000270265288IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MLFPHMSSLL PQSGQNCFRS DHDQTNSSVK SEASSSRINH YSLLMKAIHN TQEASNHSNN  60
DHGNHVEAMK AKIIAHPHYS TLLQAYLDCQ KIGAPPEVID RITATRQDFE AQQRSTASVA  120
VSRDPELDQF MEAYCDMLVK YREELTRPIQ EAMDFIRRIE SQLSMLCQGP IHVLNHPDGK  180
NEGIGSSDEE QENNSGGEID PRAEDRELKN HLLKKYSGYL SSLKQELSKK KKKGKLPKEA  240
RQKLLTWWEL HYKWPYPSES EKVALAESTG LDQKQINNWF INQRKRHWKP SEDMQFMVMD  300
GLQHPQHAAL YMDAHYMGDG PYRLGP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010421735.10.0PREDICTED: homeobox protein knotted-1-like 1 isoform X2
SwissprotP466390.0KNAT1_ARATH; Homeobox protein knotted-1-like 1
TrEMBLR0FIH20.0R0FIH2_9BRAS; Uncharacterized protein
STRINGAT4G08150.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65662335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.10.0KNOTTED-like from Arabidopsis thaliana