PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA17G00076
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family CPP
Protein Properties Length: 359aa    MW: 40743 Da    PI: 8.5559
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA17G00076genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.67.7e-16100140242
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                 ++k+CnCkk+kClk+YC+Cfaag++C+e C+C +C Nk+++
  AA17G00076 100 SCKRCNCKKTKCLKLYCDCFAAGVYCTEPCSCIECLNKHKH 140
                 589***********************************986 PP

2TCR52.51e-16186225140
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 ++k+gCnCkks Clk+YCeC+++g+ Cs +C+Ce+CkN+ 
  AA17G00076 186 RHKRGCNCKKSTCLKRYCECYQSGVGCSVNCRCEGCKNSF 225
                 589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.9E-1499140IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.198100226IPR005172CRC domain
PfamPF036381.1E-11102137IPR005172CRC domain
SMARTSM011142.3E-17186227IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.6E-12188224IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MSAESDEDNW KRILSDMEPQ VLYEDLDQLR NFTNETCNTR NLHRGLHQNA VVTSSSSNPR  60
NAMTQTGEDR GQDGQKSLNL EDLTPKRHKS EEGRENRKPS CKRCNCKKTK CLKLYCDCFA  120
AGVYCTEPCS CIECLNKHKH EDKVLAARKQ IETRNPLAFT PKVIRISQYM VKKGDGSSGK  180
TSGSARHKRG CNCKKSTCLK RYCECYQSGV GCSVNCRCEG CKNSFGRKRG SNENEQDKEN  240
EMCEQVMQHN IYSTPLRTPL GELANNQSFY TPPPAPFRDG SSSSNLLKSI EMISRTMPRD  300
LEPVNGMPMM IRDERGDQVM SEFTVQVPRG NDNNIAAESW RNASSRKLVF IPKFPDLYR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-20902234120Protein lin-54 homolog
5fd3_B1e-20902234120Protein lin-54 homolog
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA17G00076
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGCagra.1189s0049.1.p1e-76(Capsella grandiflora)
STRINGXP_006299680.11e-76(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15696813
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.14e-73Tesmin/TSO1-like CXC domain-containing protein