PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA15G00093
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family SBP
Protein Properties Length: 183aa    MW: 20734.2 Da    PI: 9.365
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA15G00093genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP136.77e-4365141177
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 +Cqv++C+adl+eak+yhrrhkvCevh+ka++v+v g++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++
  AA15G00093  65 MCQVDRCTADLKEAKQYHRRHKVCEVHAKASAVIVVGVSQRFCQQCSRFHELAEFDEAKRSCRRRLAGHNERRRKSS 141
                 6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-3359127IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.46263140IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.28E-3865144IPR004333Transcription factor, SBP-box
PfamPF031101.1E-3266139IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MDGKITQGQG YLMSKASVSY LVDEEMENDM DGEDEVGREE EKRKGVMDRV RGASGSGGDR  60
ASSRMCQVDR CTADLKEAKQ YHRRHKVCEV HAKASAVIVV GVSQRFCQQC SRFHELAEFD  120
EAKRSCRRRL AGHNERRRKS SGESFEGSSR RGVTGQLIQN QDRARVEMTL PMSNSSFKRP  180
QIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-4452139184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010462181.11e-100PREDICTED: squamosa promoter-binding-like protein 4 isoform X2
SwissprotQ9S7581e-85SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLA0A0D3CQM41e-96A0A0D3CQM4_BRAOL; Squamosa promoter-binding-like protein
STRINGBra039656.1-P2e-93(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.11e-58squamosa promoter binding protein-like 5