PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA159G00002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family TCP
Protein Properties Length: 359aa    MW: 40896.8 Da    PI: 9.2797
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA159G00002genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP135.25.6e-421122452136
          TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaakskk 99 
                  +gkkdrhski T++g+RdRR+Rls+++a++fFdLqd+LGfdk+sktieWL+ ++k +ik+l ++ + ++   e e++ +  ++++++k ++ +   +k
  AA159G00002 112 TGKKDRHSKIFTAQGPRDRRMRLSLQIARKFFDLQDMLGFDKASKTIEWLFSKSKSSIKQLKESLAAAN-GDEGEEEFEHIQADEKEKDETLEVIVSK 208
                  79**************************************************************44444.2234444444444445555555555555 PP

          TCP 100 sqksaasalnlakesrakarararertrekmriknkl 136
                  +  ++ + + + kesr++ar+rarert  km+++++l
  AA159G00002 209 RIPKTIESSCKTKESRERARKRARERTMTKMKMRSSL 245
                  5555555678888********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.7E-37112241IPR005333Transcription factor, TCP
PROSITE profilePS5136935.797114172IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137010.384221238IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MFPSLDTNGY NLFDSLNPSQ TSMLPSFTTH HIQNPNSHHS FPFSQDFLSN CGDDPSLETQ  60
LLLQSQDVFG SFDGNNLDVS PRKVNKKREQ KKKKEKCGNG SKVKQIAPRR RTGKKDRHSK  120
IFTAQGPRDR RMRLSLQIAR KFFDLQDMLG FDKASKTIEW LFSKSKSSIK QLKESLAAAN  180
GDEGEEEFEH IQADEKEKDE TLEVIVSKRI PKTIESSCKT KESRERARKR ARERTMTKMK  240
MRSSLEHNQE PKRIKITNDS NGAKVEVENQ EQEWSKVNIE ENQIDSVSII EKFLGLNTNS  300
SSSSIFGGSE ESYTSLIISP KDVISTAVLR EGNRTLKTST EEEKTPSSAS FSVYDYLCY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18694KREQKKKKE
2223233RERARKRARER
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that prevents axillary bud outgrowth. May also delay early axillary bud development. Probably involved in the auxin-induced control of apical dominance. {ECO:0000269|PubMed:17307924}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA159G00002
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed transiently after shoot apical meristem (SAM) decapitation (release from apical dominance). {ECO:0000269|PubMed:17307924}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002888684.11e-120transcription factor TCP12 isoform X2
SwissprotA0AQW41e-114TCP12_ARATH; Transcription factor TCP12
TrEMBLD7KWG51e-119D7KWG5_ARALL; BRANCHED2
STRINGfgenesh1_pm.C_scaffold_20009331e-119(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116322533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.11e-93TCP domain protein 12