PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA131G00004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family CPP
Protein Properties Length: 219aa    MW: 24532.4 Da    PI: 8.1495
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA131G00004genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR31.73e-10831081540
          TCR  15 kkYCeCfaagkkCseeCkCedCkNke 40 
                  k YC+Cfaa+++C+e+C+C dC+Nk 
  AA131G00004  83 KSYCDCFAAEAYCGETCSCIDCFNKP 108
                  99**********************96 PP

2TCR45.61.4e-14177214340
          TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  k  CnC+ks+ClkkYCeC++ g+ Cs  CkC++CkN+ 
  AA131G00004 177 KGACNCRKSNCLKKYCECYKGGVGCSLYCKCQGCKNTF 214
                  568*********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163427.46875215IPR005172CRC domain
SMARTSM011140.001383110IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.1E-783107IPR005172CRC domain
SMARTSM011141.5E-10175216IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.5E-11179213IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MEMDLLQIIP KYSPDPSSFA KLVIDVEEKK LLKTFRRKKA STMEMDLLQI IPPKYSSTSS  60
FAKLVIDVEL SLLPHAPQED LDKSYCDCFA AEAYCGETCS CIDCFNKPVH EDVLMASRKQ  120
IESRNPFAFS PKLIKSLDSV PETETGTEVY KDSSSPLIKL INNAMDKTKT RASTRYKGAC  180
NCRKSNCLKK YCECYKGGVG CSLYCKCQGC KNTFGTRDG
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA131G00004
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001328549.13e-50TESMIN/TSO1-like CXC 2
RefseqNP_193213.53e-50TESMIN/TSO1-like CXC 2
SwissprotF4JIF53e-51TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLD7MBC72e-49D7MBC7_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.7__2853__AT4G14770.14e-50(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15696813
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-53TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]