PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA12G00075
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family TALE
Protein Properties Length: 443aa    MW: 49158.7 Da    PI: 6.5123
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA12G00075genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.41.1e-073844172154
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 k +yp++e++++L +++gL+ +q+ +WF N+R +
  AA12G00075 384 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 417
                 469*****************************87 PP

2ELK28.72.9e-10338359122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELKh+L+++Y+++++++++E++
  AA12G00075 338 ELKHELKQGYKEKIVDIREEIL 359
                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1014476.28E-52433No hitNo description
SMARTSM012551.6E-19174218IPR005540KNOX1
PfamPF037901.2E-17177217IPR005540KNOX1
SMARTSM012564.1E-28229284IPR005541KNOX2
PfamPF037912.2E-20233283IPR005541KNOX2
PROSITE profilePS512139.969338358IPR005539ELK domain
PfamPF037891.0E-6338359IPR005539ELK domain
SMARTSM011886.1E-4338359IPR005539ELK domain
PROSITE profilePS5007111.726358421IPR001356Homeobox domain
SuperFamilySSF466891.11E-15360424IPR009057Homeodomain-like
SMARTSM003892.4E-11360425IPR001356Homeobox domain
CDDcd000863.80E-12361422No hitNo description
Gene3DG3DSA:1.10.10.602.8E-25365422IPR009057Homeodomain-like
PfamPF059201.3E-17378417IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MAFHHNHLSQ DLSFNHFTEQ HQQPPPPPPP PPPQQQQQRQ QQQQHQQHFQ EAPPPNWLNT  60
ALLRSDNNFL NLHTATGNTT AASSSDSPSS AANQWLSRSS SSFLQRNAGS NAAATTAGAV  120
GDVIEDVSGG AEPMIGGEMK SGDSGAMNNK NDGGATAENS GLATAEGVVS WQNARHKAEI  180
LSHPLYEQLL SAHVACLRIA TPVDQLPRID AQLAQSQHVV AKYSALGAAQ GLVGDEKELD  240
QFMTHYVLLL CSFKEQLQQH VRVHAMEAVM ACWEIEQSLQ SLTGVSPGEG MGATMSDDED  300
EQVESDANLF DGSLDVLGFG PLIPTESERS LMERVRQELK HELKQGYKEK IVDIREEILR  360
KRRAGKLPGD TTSVLKAWWQ SHSKWPYPTE EDKARLVQET GLQLKQINNW FINQRKRNWH  420
SNPSSSTVLK NKRKRKKINY AEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12361425872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1414436RKRNWHSNPSSSTVLKNKRKRKK
2432436RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3529660.0AK352966.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-12-H10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394769.10.0hypothetical protein EUTSA_v10004250mg
SwissprotP480000.0KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLV4K3J90.0V4K3J9_EUTSA; Uncharacterized protein
STRINGAT5G25220.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.20.0KNOTTED1-like homeobox gene 3