PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA128G00002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family NAC
Protein Properties Length: 334aa    MW: 37760.1 Da    PI: 8.5964
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA128G00002genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.66.7e-55221491128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeel+++yL +k+++++++  ++i++vd++k+ePw+Lp+k+k + kewyfFs rd+ky+tg r+nrat++gyWk+tgkdke++++ ++
  AA128G00002  22 LPPGFRFHPTDEELISYYLVNKISDHNFTG-KAIADVDLNKSEPWELPEKAKMGGKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEIFNStTS 118
                  79*************************999.88***************99999****************************************98788 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  el+g+kktLvfy+grap+gekt+Wvmheyrl
  AA128G00002 119 ELIGMKKTLVFYRGRAPRGEKTSWVMHEYRL 149
                  89***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-6317171IPR003441NAC domain
PROSITE profilePS5100561.16922171IPR003441NAC domain
PfamPF023651.3E-2823149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MDNQEDHHIN NQQNKKKEEE ALPPGFRFHP TDEELISYYL VNKISDHNFT GKAIADVDLN  60
KSEPWELPEK AKMGGKEWYF FSLRDRKYPT GVRTNRATNT GYWKTTGKDK EIFNSTTSEL  120
IGMKKTLVFY RGRAPRGEKT SWVMHEYRLH SKSTFRTSKQ DEWVVCRVFK KTEATKKYIS  180
SSSNSTNTSH HHNNNNNNTR SSSSIYSSDL NSNHILQQLP QPLINHHDPF NRSLMANAVH  240
LAELSRVFRA STESGPTLQS LQPHLMNYNM PMSGLNLNLG GALVQPPSTV SLDDVVAVSA  300
ASGMGGNGSF VGENGFGNVE MSQCMDLDGY WPSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-5981773171NO APICAL MERISTEM PROTEIN
1ut4_B8e-5981773171NO APICAL MERISTEM PROTEIN
1ut7_A8e-5981773171NO APICAL MERISTEM PROTEIN
1ut7_B8e-5981773171NO APICAL MERISTEM PROTEIN
4dul_A8e-5981773171NAC domain-containing protein 19
4dul_B8e-5981773171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA128G00002
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296338.11e-174protein CUP-SHAPED COTYLEDON 1
TrEMBLR0G1T71e-172R0G1T7_9BRAS; Uncharacterized protein
STRINGXP_006296338.11e-173(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM68512841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-164NAC domain containing protein 38