PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA123G00013
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family TALE
Protein Properties Length: 540aa    MW: 60776.9 Da    PI: 6.4116
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA123G00013genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.21.3e-083413781954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yp+ +++  LA+++gL+  qV++WF N R +
  AA123G00013 341 FEHflHPYPKDSDKIMLARQTGLSRGQVSNWFINARVR 378
                  664559******************************88 PP

2BELL119.81.2e-38203274172
         BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  erq+lq+k +kLls+l+eVd+ Ykqy++q+q+v+ssF+++ag g+akpYt+lAl++iSrhFr+L+dai++qi
  AA123G00013 203 ERQDLQNKLTKLLSILDEVDRTYKQYYQQMQIVVSSFDVIAGSGAAKPYTALALQTISRHFRSLRDAISGQI 274
                  799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.4E-62135272IPR006563POX domain
PfamPF075268.4E-46141271IPR006563POX domain
PROSITE profilePS5007111.742319382IPR001356Homeobox domain
SMARTSM003895.5E-9322386IPR001356Homeobox domain
CDDcd000862.87E-11322383No hitNo description
SuperFamilySSF466896.84E-17323389IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-27325388IPR009057Homeodomain-like
PfamPF059201.0E-17339378IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MTTYHINGGS RDSTETPLLY SRQQCFPANT SMLYMNPQVS FSATEANVSS VSPLMDIQDF  60
SSWRAQTEDD NNGRNGFPLM SSCLTGQGLS LSLSSQILPG IHQNLPFRNN PNIDNNISRD  120
EQSRGNNEFA TQVFPGLTRT IHNSKYLKAA QELLDEAVNV KKALKKFQPE VNKNDLQERS  180
GDVSQNLQNS ITNPPPVEIP HAERQDLQNK LTKLLSILDE VDRTYKQYYQ QMQIVVSSFD  240
VIAGSGAAKP YTALALQTIS RHFRSLRDAI SGQIIATRKN LEEHDGTDGK GVGISRLRNV  300
DQQVRQQRAM QQLGVMQPPH AWRPQRGLPD NSVSILRAWL FEHFLHPYPK DSDKIMLARQ  360
TGLSRGQVSN WFINARVRLW KPMVEEMYKE EFIDTLENDS NLSPEITPKP AEIRPASDQE  420
CSQDQQVGTS SKHNYGHESG GESCSMVQDT VTCSDQMMVV PQYHVTEMPR LGTSGVSLTL  480
GLQNTESHGN VPMSEIREID TYQDAIPGSH FGYINPSNRQ HQLGSSQLLH DFVERYRTQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-15328386563Homeobox protein Meis2
3k2a_B4e-15328386563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006409439.10.0hypothetical protein EUTSA_v10022660mg
SwissprotQ9SIW10.0BLH7_ARATH; BEL1-like homeodomain protein 7
TrEMBLV4M7810.0V4M781_EUTSA; Uncharacterized protein
STRINGAT2G16400.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28692563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-180BEL1-like homeodomain 7