PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA10G00239
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family WOX
Protein Properties Length: 280aa    MW: 30456.6 Da    PI: 6.9533
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA10G00239genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.47.9e-162383257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                r+R+++++eq+ +Le+ F++   +p +ee  ++ k l     + +++V++WFqNrR + ++
  AA10G00239 23 RSRWSPKPEQILILESIFNSgMVNPPKEETVRIRKMLekfgAVGDANVFYWFQNRRSRSRR 83
                89*****************99*************************************997 PP

2Wus_type_Homeobox107.48.6e-352285265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +r+RW+P+peQi iLe++++sG+++P+kee+ ri+++Le++G+++d+NVfyWFQNr++R+r++q
         AA10G00239 22 VRSRWSPKPEQILILESIFNSGMVNPPKEETVRIRKMLEKFGAVGDANVFYWFQNRRSRSRRRQ 85
                       589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.24E-141591IPR009057Homeodomain-like
PROSITE profilePS5007111.5311984IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.3E-91990IPR009057Homeodomain-like
SMARTSM003891.1E-62188IPR001356Homeobox domain
PfamPF000461.4E-132383IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MDHQTPHSHS PSASGSTSTE PVRSRWSPKP EQILILESIF NSGMVNPPKE ETVRIRKMLE  60
KFGAVGDANV FYWFQNRRSR SRRRQRQLQA AASAAAAAAS NAITSDQTMM MNMNQNSLGH  120
NDLGFGNTSN YFFGGSSQAS SFFLGLSSTS SSSSCSSSSS TCSSSCSCGG CDHHSNNGME  180
NLLTMSGQMG YHHHEVNHHH HSSNVASILC PSDQNSNFQY QQGVITVFIN GVATEVSRGG  240
IDMKSMFGEE MVLVHSSGLL LPTDEFGFLI HSLQHGEAYF
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00330DAPTransfer from AT3G03660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA10G00239
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001118563.11e-120WUSCHEL related homeobox 11
SwissprotQ6X7J31e-111WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLB3H5D31e-119B3H5D3_ARATH; WUSCHEL related homeobox 11
STRINGBostr.19046s0084.1.p1e-121(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28192768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.12e-89WUSCHEL related homeobox 11
Publications ? help Back to Top
  1. Hu X,Xu L
    Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis.
    Plant Physiol., 2016. 172(4): p. 2363-2373
    [PMID:27784768]
  2. Sheng L, et al.
    Non-canonical WOX11-mediated root branching contributes to plasticity in Arabidopsis root system architecture.
    Development, 2017. 144(17): p. 3126-3133
    [PMID:28743799]
  3. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]
  4. Baesso B, et al.
    Transcription factors PRE3 and WOX11 are involved in the formation of new lateral roots from secondary growth taproot in A. thaliana.
    Plant Biol (Stuttg), 2018. 20(3): p. 426-432
    [PMID:29450949]