PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA10G00136
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family CPP
Protein Properties Length: 654aa    MW: 71519.6 Da    PI: 4.8301
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA10G00136genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.53.5e-15458496240
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 ++k+C+C+kskClk+YC+Cfaag +C e C+C++C+Nk 
  AA10G00136 458 SCKRCRCRKSKCLKLYCDCFAAGLYCIEPCSCQNCFNKP 496
                 589**********************************96 PP

2TCR52.21.2e-16543581139
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                 ++k+gCnCkks ClkkYCeCf  g+ Cs +C+C +CkN 
  AA10G00136 543 RHKRGCNCKKSGCLKKYCECFLMGVGCSPSCRCIGCKNV 581
                 589***********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.0E-17457498IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.745458583IPR005172CRC domain
PfamPF036381.7E-10460495IPR005172CRC domain
SMARTSM011147.6E-17543584IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-12545580IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 654 aa     Download sequence    Send to blast
MDTPEKNRIA AVSFCNFEDS PVFQYINDLS PIEPVKQART DNVLHSMAFA SPPSIFSSPQ  60
INSLRDSRFS IKRHRSPDLS TPSGFLGGTV RDSPDALEAG KASSICEEWQ KFEGPEHLDN  120
ESEAKPFKEH ISLAIELAKS LKNGRDGCDI QMGSCDEAST DAENAIGRAG SMEQSDELCR  180
QPNDPLESDA ELDGVLQTNE KEANIDFGLE KITSDVGGIQ NNEQHNPKIS DPRFSSLASG  240
PQQFSLCYND SGNLSESGGS CSGQVAAEAP DISISRSSEA AAIDSTAKAE DTEESGFQPS  300
RKQRSVRRRC LTYDVGGSNK RIPLRDCTND PPIEITPVNE APKPHKCSDL SKKDTDKILP  360
TPRTIGLHLN GLVNSLISND RNILICKAGR VLSQGPTTFN RNLEDEFSTP VSTKGELVSS  420
DNTTMEEIPE RSMEGESFGD ELTAVNGQLS QGLDELGSCK RCRCRKSKCL KLYCDCFAAG  480
LYCIEPCSCQ NCFNKPIHEN IVMNTRRQIE ARNPLAFAPK VISTSHSAID LVDENNKTPA  540
SARHKRGCNC KKSGCLKKYC ECFLMGVGCS PSCRCIGCKN VFGQTNEQFH FPCLVESDTV  600
TMNEENRDNN NLLALELNSH GDKTVSSSTK IEEEGSGYEV CNEIIRREDA SVAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1746058112121Protein lin-54 homolog
5fd3_B1e-1746058112121Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA10G00136
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023642810.10.0protein tesmin/TSO1-like CXC 4 isoform X1
SwissprotQ84JZ80.0TCX4_ARATH; Protein tesmin/TSO1-like CXC 4
TrEMBLA0A178VLW70.0A0A178VLW7_ARATH; Uncharacterized protein
STRINGBostr.2570s0210.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148401620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04850.10.0Tesmin/TSO1-like CXC domain-containing protein