PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA10G00033
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family M-type_MADS
Protein Properties Length: 325aa    MW: 36588.2 Da    PI: 6.7955
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA10G00033genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF51.31.5e-161051243
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
      SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                +i n+  r+ tf kR++g++KK +ELS+LCd++++ i++s+ 
  AA10G00033 10 FIVNDATRKATFKKRKKGLIKKVNELSTLCDVKACAIVYSPY 51
                789*************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-25160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-24185IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.591161IPR002100Transcription factor, MADS-box
CDDcd002668.07E-20284No hitNo description
PRINTSPR004041.6E-10323IPR002100Transcription factor, MADS-box
PfamPF003194.6E-171051IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MTRKKVKLAF IVNDATRKAT FKKRKKGLIK KVNELSTLCD VKACAIVYSP YDSAPEVWPP  60
SIPAVKDVLT DFKMLSEVDQ KKRMFNQESF LDLRIKKTIE LIEKQRRDNL EIEMREAMFK  120
CLVGDLSPIY GFDYENLNNL KSVIDQHLRD VNRRLEILTN SLLQNGESSS AAAAVGSAFG  180
AVTNAANAGS AMAMAAPTGS YFNFTQHNHH HHQQQQVYYP VAAPNVDVYG HNPNLNLNQQ  240
QIHYPNWNQN QNQIENQNQN QNQQVWMMNN GVEQMSVASM DDTQFQYGTM AGPVAASAMD  300
ASNSGVTVMG SETMDDGWPA EYFHN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAFIVNDATRKATFKKRK
22125KKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA10G00033
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9FJK39e-57AGL80_ARATH; Agamous-like MADS-box protein AGL80
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.14e-50AGAMOUS-like 80
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]