PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA102G00247
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family WRKY
Protein Properties Length: 447aa    MW: 48794.6 Da    PI: 8.8166
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA102G00247genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY79.24.4e-25157213259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  +DgynWrKYGqK+vk+ + +rsYYrCt+++C++kk +e+s++ ++v+e++++g+H he
  AA102G00247 157 RDGYNWRKYGQKQVKSPKGSRSYYRCTYSDCCAKK-IECSNDLGNVIEVVNKGSHSHE 213
                  7********************************98.*********************8 PP

2WRKY100.11.4e-31317373359
                  -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ e++++v+itY+g Hnh+
  AA102G00247 317 DGYRWRKYGQKMVKGNPNPRNYYRCTSAGCPVRKHIETAVENTTAVIITYKGVHNHD 373
                  9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.5E-19153215IPR003657WRKY domain
SuperFamilySSF1182903.53E-19154215IPR003657WRKY domain
SMARTSM007748.1E-23156214IPR003657WRKY domain
PROSITE profilePS5081116.317158215IPR003657WRKY domain
PfamPF031065.2E-17158212IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.1E-32300375IPR003657WRKY domain
PROSITE profilePS5081132.386310375IPR003657WRKY domain
SuperFamilySSF1182904.58E-27311375IPR003657WRKY domain
SMARTSM007741.5E-35315374IPR003657WRKY domain
PfamPF031061.2E-23317373IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MEEIGSGEAE VYAAEKTEKV ETEKKVGKSS VEELGQLRDD ADVSDNAVRG TLDKDQLKGV  60
RENSAVKPNG EDVIKVKETD SCKVTVVTTM EKSHAQTVVL NPPSMVEPSQ SLNSLSKPAS  120
SAQGSSLVST TPTQEPKSGS RNVNSLSVSP VLRTPARDGY NWRKYGQKQV KSPKGSRSYY  180
RCTYSDCCAK KIECSNDLGN VIEVVNKGSH SHEPPRKSNL SIRENRNVPY SLEDTSVARD  240
QSISAKDNIC ESRIIVERKR ICSSVSGGLG ENETEDEPEP KRRLKKDNLP SSDSGSRPGK  300
KHKFVVHAAG DVGISGDGYR WRKYGQKMVK GNPNPRNYYR CTSAGCPVRK HIETAVENTT  360
AVIITYKGVH NHDMPVPKKR HGPPSSVLVA AAAPTSMRTR PDDQVTATQC IAGRESEQSN  420
EAMDVGGEKV MESARTLLSI GFEIKQC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-25303375274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567862.30.0WRKY DNA-binding protein 32
RefseqXP_006412655.10.0hypothetical protein EUTSA_v10025126mg
SwissprotP595830.0WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLV4MMR70.0V4MMR7_EUTSA; Uncharacterized protein
STRINGAT4G30935.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.10.0WRKY DNA-binding protein 32