PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA102G00062
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family CPP
Protein Properties Length: 492aa    MW: 53888.7 Da    PI: 7.9374
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA102G00062genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR461.1e-144787142
          TCR  1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42
                 ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e+
  AA102G00062 47 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVEN 87
                 589**************************.********9875 PP

2TCR512.9e-16133172140
          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  AA102G00062 133 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNFE 172
                  589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.5E-164787IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.13648173IPR005172CRC domain
PfamPF036385.9E-114984IPR005172CRC domain
SMARTSM011141.5E-19133174IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.3E-13136171IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MGIAGQVPAV TPNPPSQLQN NPIRIPKPES PKSRPRPAME SRDGTPQKKK QCNCKHSRCL  60
KLYCECFASG TYCDGCNCVN CFNNVENEPA RREAVEATLE RNPNAFRPKI ASSPHATRDK  120
REEIGEVVVL LGKHNKGCHC KKSGCLKKYC ECFQANILCS ENCKCLDCKN FEGSEERQAI  180
FHGEHANNIA FLQQAANAAI TGAIGSSGFA SAPPPKRRKA QEILFNQTTP KDSSSTQRLN  240
HFPQSNGGRA SGSPRPVPRG SGNVSLPSSK CVYRSLLADT IQPHDVKALC SVLVTVSGEV  300
KTLADQRNET ENRVEDETET TLASFGHETK GSDDDLRINQ TDLSSKESPL SPATLALMCD  360
EKDTILMVAA SPNGVVDHGC RTNSEYINQQ ENQSEIYAEQ ERVILSKFRD CLSRLVSYAE  420
LKESNCSSLA RMQLLHSPVN VPATVKIENG VEEVPISNGV SRPITQTTLK QQPLQLTTST  480
PKTQQEHNIG QK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-314918211132Protein lin-54 homolog
5fd3_B2e-314918211132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA102G00062
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006412891.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLV4MD100.0V4MD10_EUTSA; Uncharacterized protein
STRINGXP_006412891.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein