PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan021500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 700aa    MW: 75041.5 Da    PI: 5.0455
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-310160992PU_refplantGDBView CDS
gnl|UG|Aan#S41940390PU_unrefUnigeneView CDS
gnl|UG|Aan#S41973706PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.97.1e-11104145346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE   ++++ k++G++ ++ +++++  ++t +qck ++ k
        Aan021500 104 NWTDEEKSNFIKGLKLYGKN-FSMVSQCVR-TKTSNQCKVYYSK 145
                      8*****************99.*********.********99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129311.531100151IPR017884SANT domain
SMARTSM007172.2E-8101149IPR001005SANT/Myb domain
SuperFamilySSF466898.22E-11102148IPR009057Homeodomain-like
CDDcd001672.12E-8104143No hitNo description
Gene3DG3DSA:1.10.10.601.0E-6104145IPR009057Homeodomain-like
PfamPF002494.4E-8104145IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
XDMLGAASAM VANVGTSGGD GDRLNDFANL CNEQETAAAD VLAGICGSIS PEALGSCITS  60
SVDNGDNRHQ VRTCQKLGGY LLKNVGEDDS CSDDSCGEEM ESCNWTDEEK SNFIKGLKLY  120
GKNFSMVSQC VRTKTSNQCK VYYSKARNLL GLDVNKFEPG SEGTTGANHG GGSDDHEGTC  180
MVDSGSVISH DKSSLDCKME PHSSEFGEEQ SESDVNVVNK EPEHLVSDIK SEDELVGERG  240
LNGNLEGAAD SEATEAANLE ISPQNTCSDS ASGAKVEESE HQLANGISCN GNAIEDLNST  300
SCYSRGRSLD LTLDRGNGMD LNASLENIST QEPVNGLVAS NLFPQDPTVI PKRRTVSQDD  360
VSSRLSFRKS SQRCSSTDGY HLHLPKHSLL DCAESSQMLR GCTVTASNNK GINGSSSYSK  420
TQCNFKLDES LLMPTGDSLQ ICNERRRSSS SDVEKPSGNG DVKLFGQILT NTSSNKLQPQ  480
PVLKANGSAQ ESEKPKWCKV LNLKFDHHRK LASLDLTRRN EYASGVENNL QMSSHGFWDG  540
NRIQTGFPSL PDSAVLLAKY PAAFTPFSAA SKLDQDQQLH SSLKRGNNLN VVSGFQPRKL  600
SSNNGVANYN VFGSKEVLQP FTVDKKLLPG MPRSKELEVM SGVQQGIGIM GMNVNVVGGA  660
CNGVSDPVAA IRMHYAKTQQ FTNGGGESWR STGSSDIGSR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Aan.111930.0trichome
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022006221.10.0uncharacterized protein LOC110904686, partial
TrEMBLA0A2U1QDC00.0A0A2U1QDC0_ARTAN; Homeodomain-like protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-17MYB family protein