PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan021282
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 214aa    MW: 24724.3 Da    PI: 10.772
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-7392PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.94.1e-074688347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT +E+el   a +q G++ +++I ++++  +   q++++++ +
        Aan021282 46 AWTRQEEELYFTALRQVGKN-FEKITSRVQ-SKNKDQVRHYYYRL 88
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.87E-103893IPR009057Homeodomain-like
PROSITE profilePS5129313.4254293IPR017884SANT domain
SMARTSM007171.7E-64391IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-64491IPR009057Homeodomain-like
CDDcd001671.91E-54689No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MESQIPIDQE ASTQCDDVLI KDVITSETNL TASNQPVKKQ TRQWAAWTRQ EEELYFTALR  60
QVGKNFEKIT SRVQSKNKDQ VRHYYYRLVR RMNKLLGPEL SLDPKNTKET NAAMLRWWSL  120
LEKHSCKASK LHLKPRRFKA FMGALEKHIL KDRKKNTRKR PKQGGNSSTT PTIKPSRQRN  180
KSGITSTDAY KKWEKAAIAG VSLVADAAEH LERT
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers, roots and leaves. {ECO:0000269|PubMed:15047893}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021985478.11e-123TSL-kinase interacting protein 1
SwissprotQ8LJT81e-80TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLA0A2U1P7J11e-146A0A2U1P7J1_ARTAN; Homeodomain-like protein
STRINGGLYMA02G05420.21e-88(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.25e-83TSL-kinase interacting protein 1