PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan021163
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 289aa    MW: 31594.4 Da    PI: 6.5175
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-64805PU_refplantGDBView CDS
gnl|UG|Aan#S55158910PU_unrefUnigeneView CDS
PUT-183a-Artemisia_annua-64806PU_unrefplantGDBView CDS
PUT-183a-Artemisia_annua-64803PU_unrefplantGDBView CDS
PUT-183a-Artemisia_annua-64804PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.29.4e-1487131347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
        Aan021163  87 PWTEDEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 131
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.40680136IPR017930Myb domain
SuperFamilySSF466891.27E-1682137IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-1783134IPR006447Myb domain, plants
SMARTSM007177.6E-1084134IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-1086131IPR009057Homeodomain-like
CDDcd001675.43E-987132No hitNo description
PfamPF002495.5E-1187131IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MTSSDESSNE IMLFGVRVKV DPMRKSVSMN DLSHYVHLQT PPLTNAVDDN GGGYVSADDV  60
IVPDHHRSNG SAGGGGGGAR ERKRGVPWTE DEHKLFLLGL QKVGKGDWRG ISRNFVKTRT  120
PTQVASHAQK YFLRRSNLNR RRRRSSLFDM TTDSVGAIPM EEQVSEDNTD KAASPQISPL  180
SGFPMATFPA TVSPVPSQVP VENQMETVTF SNYDQINAAP ALPVYPIALL PTPDTSTMAD  240
LNMIQKHEMD SLSLSLNLSL SYDHNNRMNT PAYQAMPSFN SGDGLISVG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Aan.80150.0trichome
Functional Description ? help Back to Top
Source Description
UniProtBinds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269|PubMed:21030505}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269|PubMed:21030505}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024970440.11e-100transcription factor MYB1R1-like
SwissprotQ2V9B02e-63MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A2U1P1H11e-166A0A2U1P1H1_ARTAN; Homeodomain-like protein
STRINGEMJ106094e-80(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.23e-47MYB_related family protein
Publications ? help Back to Top
  1. Shin D, et al.
    Expression of StMYB1R-1, a novel potato single MYB-like domain transcription factor, increases drought tolerance.
    Plant Physiol., 2011. 155(1): p. 421-32
    [PMID:21030505]