PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan020631
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family SBP
Protein Properties Length: 175aa    MW: 19457.8 Da    PI: 8.5044
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-3330PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP963.4e-30115174160
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS-- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekr 60 
                +Cqv++C++dls ak+yhrrhkvCevhska ++lv +++qrfCqqCsrfh lsefDe+ r
  Aan020631 115 MCQVDNCKEDLSAAKDYHRRHKVCEVHSKAGKALVGKQMQRFCQQCSRFHPLSEFDEGXR 174
                6********************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-32108174IPR004333Transcription factor, SBP-box
PROSITE profilePS5114123.974113175IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.62E-28114174IPR004333Transcription factor, SBP-box
PfamPF031105.4E-23116174IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
XTVVDDSRNS WNPKSWEWDS SRLVAKPVDM IEIQKEQQQQ QQQQQHHHQP ATNPANSDLS  60
KRSPVGQREE DGQLSLKLGG GLASVEEPVT RPTKRVRSGS PGNGGGGGGG GNYPMCQVDN  120
CKEDLSAAKD YHRRHKVCEV HSKAGKALVG KQMQRFCQQC SRFHPLSEFD EGXRX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A4e-27111170160squamosa promoter-binding protein-like 12
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in vasculature of aerial parts. Expressed in cotyledons and leaf petioles. {ECO:0000269|PubMed:15703061}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023772722.18e-76squamosa promoter-binding-like protein 14
RefseqXP_023772793.18e-76squamosa promoter-binding-like protein 14
RefseqXP_023772852.18e-76squamosa promoter-binding-like protein 14
RefseqXP_024969327.17e-77squamosa promoter-binding-like protein 14 isoform X2
SwissprotQ8RY952e-50SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A2U1NWM62e-91A0A2U1NWM6_ARTAN; SBP-like protein
STRINGXP_008373366.15e-60(Malus domestica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.17e-50squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]