PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan020466
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family SBP
Protein Properties Length: 420aa    MW: 46025.4 Da    PI: 9.2213
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-153944PU_refplantGDBView CDS
gnl|UG|Aan#S41969272PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.11.4e-39142219178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +Cqv gC+ dls+ak+yhr+h+vC+vhsk+ +v+v+gle+rfCqqCsrfh l efD +krsCr+rLa+hn+rrrk+++
  Aan020466 142 ICQVMGCDRDLSSAKDYHRKHRVCDVHSKSLKVIVAGLERRFCQQCSRFHGLPEFDGKKRSCRKRLADHNARRRKPHQ 219
                5**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.4E-32135204IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.06140217IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.45E-37141222IPR004333Transcription factor, SBP-box
PfamPF031105.2E-31143216IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MEWNTKWDWE NLAMFGSKGV ASPKKLQSTD WGFKEGQDID GSSNHSGVLG GSGGSGGSGS  60
ISASTESTFK DTTKVTKFSV DFGGGELNKS SPSLEASVCS SDQSIGLKLG KRTYFENNLP  120
RSNSSVSTVK KVKLSQQSAP IICQVMGCDR DLSSAKDYHR KHRVCDVHSK SLKVIVAGLE  180
RRFCQQCSRF HGLPEFDGKK RSCRKRLADH NARRRKPHQE TIQFNSRSLS SSYYDGPRQL  240
SFAFNNGPMV QTKPAVSSMW ENTCNSKHSV ATVKAEKYGG HDVLTHSQGV QFPNPVSMTP  300
TLSFNRNISS KGTTAGVFDQ GSSLELRRAL SLLSNNSWGS SESDFGCLDH PMHTNGPNIA  360
QQGMHSAPHG LPLLSPEYWQ VDHQSVDPHI HGTHFQGSQI LKAPYGIQYA NPMDEIVQPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-261422161084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1198215KKRSCRKRLADHNARRRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024994203.11e-163squamosa promoter-binding-like protein 12
TrEMBLA0A2U1M8A60.0A0A2U1M8A6_ARTAN; SBP-like protein
STRINGXP_009766987.11e-110(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.39e-48squamosa promoter binding protein-like 2