PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan019954
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 158aa    MW: 17689.8 Da    PI: 10.5553
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-312160995PU_refplantGDBView CDS
gnl|UG|Aan#S55015755PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.75.3e-1381125347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E++l++ + ++ G+g+W+ I+r + k+Rt+  + s+ qky
        Aan019954  81 PWTEDEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTKVASHAQKY 125
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.28974130IPR017930Myb domain
SuperFamilySSF466896.13E-1676131IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-1777128IPR006447Myb domain, plants
SMARTSM007172.0E-878128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-1080125IPR009057Homeodomain-like
CDDcd001671.15E-881126No hitNo description
PfamPF002493.4E-1081125IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MSSCDGGSNE IMLFGVRVKI DPMRKSVSMN NLSQYEQPAP LLANDGSKAD VVVSADNGYA  60
SADDVVRHQA NGGRERKRGV PWTEDEHKLF LLGLQKVGKG DWRGISRNFV KTRTPTKVAS  120
HAQKYFLRRS NLNRRRCRSS LFDMTTDSVA PMPIDTRX
Functional Description ? help Back to Top
Source Description
UniProtBinds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269|PubMed:21030505}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269|PubMed:21030505}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023730192.12e-70transcription factor MYB1R1-like
SwissprotQ2V9B02e-66MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A2U1N8721e-109A0A2U1N872_ARTAN; Homeodomain-like protein
STRINGXP_009802855.13e-68(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.24e-57MYB_related family protein
Publications ? help Back to Top
  1. Shin D, et al.
    Expression of StMYB1R-1, a novel potato single MYB-like domain transcription factor, increases drought tolerance.
    Plant Physiol., 2011. 155(1): p. 421-32
    [PMID:21030505]