PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan019948
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 243aa    MW: 26590.3 Da    PI: 7.6622
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-4869PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.82.8e-14115159347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
        Aan019948 115 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVVTRTPTQVASHAQKY 159
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007177.2357IPR001005SANT/Myb domain
CDDcd001671.44E-42955No hitNo description
PROSITE profilePS500904.3333255IPR017877Myb-like domain
PROSITE profilePS5129418.267108164IPR017930Myb domain
SuperFamilySSF466896.65E-17110165IPR009057Homeodomain-like
SMARTSM007175.0E-12112162IPR001005SANT/Myb domain
TIGRFAMsTIGR015577.1E-18112162IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.2E-11113158IPR009057Homeodomain-like
CDDcd001676.05E-11115160No hitNo description
PfamPF002493.1E-12115159IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MADKKAYGLE SRIGLSRMPC IAHFEEDSKD CWDKIAIDVP GKTAEEVKHH YELLVDDLDR  60
IESGIVPLAC YTASSDDSGS HGGDDGTSKK SGNLRYHSSE GKASKADQER RKGVAWTEDE  120
HRLFLLGLEK YGKGDWRSIS RNFVVTRTPT QVASHAQKYF IRLNSINNKD RRRSSIHDIT  180
SVNNGDVSVP QPPTNDSPGK STKQQPIYGG QPVVGTPVNL APGFSVGTPV GVPPNIDPRV  240
SSX
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young seedlings, developing leaves, sepals and trichomes. {ECO:0000269|PubMed:26243618}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021986305.11e-105transcription factor SRM1-like
SwissprotQ9FNN69e-83SRM1_ARATH; Transcription factor SRM1
TrEMBLA0A2U1NKD91e-124A0A2U1NKD9_ARTAN; Duplicated homeodomain-like superfamily protein
STRINGEMJ244544e-94(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-78MYB family protein
Publications ? help Back to Top
  1. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  2. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]