PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan019332
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family SBP
Protein Properties Length: 282aa    MW: 30999.8 Da    PI: 10.3384
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-109709PU_refplantGDBView CDS
gnl|UG|Aan#S41952363PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.42.6e-4029105278
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                C v+gC+adl +++eyhrrhkvCe+hsk+++v+++g+ qrfCqqCsrfh+l efDe+krsCr+rL++hn+rr+k+qa
  Aan019332  29 CLVDGCTADLGQCREYHRRHKVCEIHSKTAKVTIAGRDQRFCQQCSRFHSLAEFDEGKRSCRKRLDGHNRRRKKPQA 105
                **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114131.17126103IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.102.2E-322690IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.81E-3827108IPR004333Transcription factor, SBP-box
PfamPF031108.6E-3029102IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MDMSSSAKRA KTPASSTGGS NNISIIVSCL VDGCTADLGQ CREYHRRHKV CEIHSKTAKV  60
TIAGRDQRFC QQCSRFHSLA EFDEGKRSCR KRLDGHNRRR KKPQADSLSK TTTTFLSNQQ  120
GIARILSFNS PQIHLSTMLG SSRPIGFKPE SPSPTGPFNN QPPLNYLTRH PMNQGPSPPT  180
PTARNDGENH FNFLQHRPPP LAGTTRALSL LSSSPQAHQT QGIMPSVPSG IGQYGFAQEM  240
HSEAMLTESS GMTLQFQGMF NNDHASSSSS GIKQQTLSFR WD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-3119102184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
185102KRSCRKRLDGHNRRRKKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024987775.11e-139squamosa promoter-binding-like protein 13A
TrEMBLA0A2U1PLS30.0A0A2U1PLS3_ARTAN; Transcription factor, SBP-box
STRINGXP_009764314.12e-67(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-42SBP family protein