PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan018530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family SBP
Protein Properties Length: 401aa    MW: 44300.3 Da    PI: 8.4967
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-12661PU_refplantGDBView CDS
gnl|UG|Aan#S41970295PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.66.7e-4296172278
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                C v+gC+adls  keyhrrhkvCevhsk++ vl++g++qrfCqqCsrfh+l+efDe+krsCr+rL++hn+rrrk+q+
  Aan018530  96 CLVDGCNADLSGSKEYHRRHKVCEVHSKTALVLIHGQKQRFCQQCSRFHSLEEFDEGKRSCRKRLDGHNRRRRKPQP 172
                9*************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.4E-3390157IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.93293170IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.14E-3895174IPR004333Transcription factor, SBP-box
PfamPF031105.8E-3296169IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MDWNMKIPSW DFTDFDQGTI PNIDSVSGSS SYNNGGQQQG IKGNFSVDLK LGQVIDSRNE  60
FRDCLNLKGT SKMALSPSGS SKRARAVNNG VQAAGCLVDG CNADLSGSKE YHRRHKVCEV  120
HSKTALVLIH GQKQRFCQQC SRFHSLEEFD EGKRSCRKRL DGHNRRRRKP QPDTSRAASL  180
FSGHQGVTML QFSSPHVYQT TTLTNPIWTN MVKSEEEPMY SIRHPIPTHK QNPFPESSSG  240
TKKATPKQQQ FSLFHDNGSS SGSGSHLKLN HHQTAPPPKV CQQQLLTVEA NSNSYDKLFC  300
DGYSPPGRVH PVVQSVQSDC ALSLLSSSPS QTSCTALSHV MHQPNSFSVT PTNPLDTGAG  360
YGGLESIMDH DGNNMIQMGL HQHHHASRDN GAPQTLPFYW E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29961691184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1152169KRSCRKRLDGHNRRRRKP
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Weak increase of expression during floral induction. {ECO:0000269|PubMed:14573523}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024977060.10.0squamosa promoter-binding-like protein 13A
SwissprotB9DI201e-61SP13A_ARATH; Squamosa promoter-binding-like protein 13A
SwissprotP0DI111e-61SP13B_ARATH; Squamosa promoter-binding-like protein 13B
TrEMBLA0A2U1PV670.0A0A2U1PV67_ARTAN; SBP-like protein
STRINGEMJ104051e-105(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-59SBP family protein
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]