PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan018330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 364aa    MW: 39361.6 Da    PI: 7.3432
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-88701PU_refplantGDBView CDS
gnl|UG|Aan#S41954240PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.5e-14112156347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ Iar   + Rt+ q+ s+ qky
        Aan018330 112 PWTEEEHRLFLLGLQKLGKGDWRGIARNYVLSRTPTQVASHAQKY 156
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.242105161IPR017930Myb domain
SuperFamilySSF466893.37E-16107160IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-18108160IPR006447Myb domain, plants
SMARTSM007171.8E-11109159IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-11109155IPR009057Homeodomain-like
CDDcd001675.69E-10112157No hitNo description
PfamPF002493.3E-11112156IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPS RDTGTGSGVK LFGVRLTEGG GSIMKKSASM GNLSALYHPS  60
SSSSSPVAXV SPNHGGSPAS SDRIVGGGGG GGYLSDDPKR RAVAVDRKKG TPWTEEEHRL  120
FLLGLQKLGK GDWRGIARNY VLSRTPTQVA SHAQKYFIRQ CNSTRRKRRS SLFDMAPDTV  180
EESPEDQFML PPAEGADHPD NDPCSLKLSL NPDPDQSMEA AAPTETLEQD IKEETSTTVN  240
SDQLPPTMPA FYPAYIPIPF QVWPSTMTQL EEPTNNNNTG PDGTYHRVLK PIPVLSKEPV  300
NLDELVGKSS QLSLKDTDHH YIEPSSLSLT LMTEPSRQSA FHASIPVVGS SGKDKGVGNG  360
FRAI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024970566.11e-177transcription factor MYBS3
TrEMBLA0A2U1N2420.0A0A2U1N242_ARTAN; Homeodomain-like protein
STRINGAES679301e-114(Medicago truncatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-68MYB_related family protein