PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan018299
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family SBP
Protein Properties Length: 406aa    MW: 45068.1 Da    PI: 9.5708
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-100274PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.31.2e-3985162178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +Cqv++C+adl+ ak+yhrrhkv + hska+++lv +++qrfCqqCsrfh+l+efDe+krsCrrrLa+hn+rrrk+++
  Aan018299  85 VCQVDDCQADLTGAKDYHRRHKVWNSHSKATKALVGNVMQRFCQQCSRFHTLEEFDEGKRSCRRRLAGHNRRRRKTHP 162
                6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.4E-3378147IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.42883160IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.1E-3684164IPR004333Transcription factor, SBP-box
PfamPF031101.6E-2886159IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
XSAYLRVLRG SRLCLIVRLR VLMKGRGNWK KRRRVVVLDD EDEVGGLNLN LGGRVYPIPE  60
DESERWEGKS GKKSKVGGGS SNRPVCQVDD CQADLTGAKD YHRRHKVWNS HSKATKALVG  120
NVMQRFCQQC SRFHTLEEFD EGKRSCRRRL AGHNRRRRKT HPENQTNGVS LNDERTSSYL  180
LVSLLRILSS AQSNGSEPNK DQDLLAHLLR NLASLAGTVT EKNSSGSQSL QDAGTSVATP  240
EKEAMQPVRQ TVNPSGSETM HRGTLQTAAP CQIAFPSNNK APNEVGKMKL NNIDLNMVYD  300
DSQDCGFETP ENIDNVPLWL RHPQKSSPPQ TSGNSGSTAT QSPSSSSGEA QSRTDRIVFK  360
LFGRDPNELP LVLRNQILDW LLNSPTEIEG YIRPGCIILA VYLSSX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-3179159484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13034KRRRV
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during plant development. {ECO:0000269|PubMed:10524240}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000269|PubMed:16554053}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022038482.10.0squamosa promoter-binding-like protein 1
SwissprotQ9S7P55e-96SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBLA0A2U1PTF80.0A0A2U1PTF8_ARTAN; SBP-like protein
STRINGSolyc05g053240.2.11e-139(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.13e-69squamosa promoter-binding protein-like 12
Publications ? help Back to Top
  1. Jung S, et al.
    Synteny conservation between the Prunus genome and both the present and ancestral Arabidopsis genomes.
    BMC Genomics, 2006. 7: p. 81
    [PMID:16615871]
  2. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  3. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]