PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan018266
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 226aa    MW: 24351.8 Da    PI: 9.3049
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-144570PU_refplantGDBView CDS
gnl|UG|Aan#S41959231PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.31.8e-1376120347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ + +++G+g+W++I+r +  +R++ q+ s+ qky
        Aan018266  76 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVVTRSPPQVASHAQKY 120
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512935.487120IPR017884SANT domain
PROSITE profilePS5129417.21769125IPR017930Myb domain
SuperFamilySSF466891.12E-1571126IPR009057Homeodomain-like
SMARTSM007175.2E-1173123IPR001005SANT/Myb domain
TIGRFAMsTIGR015577.9E-1773124IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.1E-1074119IPR009057Homeodomain-like
PfamPF002493.5E-1176120IPR001005SANT/Myb domain
CDDcd001674.12E-1076121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
PGKTAEEVKH HYELLVDDLD RIESGVVPLP CYTASSDDSG SRGGDDGTSK KSGNLRHHSS  60
EGKASKADQE RRKGVAWTED EHRLFLLGLE KYGKGDWRSI SRNFVVTRSP PQVASHAQKY  120
FIRQNSLNRD RRRTSIHDIT SVNNGDTSSP ITGQTNASPA GKSSNQPPHA TSDGGTTVGL  180
PLAVGTPVNI TPQSHMAYGI IAPGHLGPMT YPGPMAYPTS NTSSHR
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young seedlings, developing leaves, sepals and trichomes. {ECO:0000269|PubMed:26243618}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024994822.11e-113transcription factor SRM1 isoform X1
RefseqXP_024994823.11e-113transcription factor SRM1 isoform X1
RefseqXP_024994824.11e-113transcription factor SRM1 isoform X1
SwissprotQ9FNN63e-77SRM1_ARATH; Transcription factor SRM1
TrEMBLA0A2U1PWH81e-163A0A2U1PWH8_ARTAN; Homeodomain-like transcriptional regulator
STRINGXP_009613368.14e-92(Nicotiana tomentosiformis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.15e-73MYB family protein
Publications ? help Back to Top
  1. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  2. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]