PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan018145
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 128aa    MW: 14957 Da    PI: 9.6431
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-29447PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-164387147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT++E++++++a k++G   W+ I +++g ++t+ q++s+ qk+
        Aan018145 43 REKWTQDEHKKFLEALKLYGRA-WAQIEEHVG-NKTAIQIRSHAQKF 87
                     789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.34E-163791IPR009057Homeodomain-like
PROSITE profilePS5129420.7463892IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.0E-103990IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-164190IPR006447Myb domain, plants
SMARTSM007171.0E-124290IPR001005SANT/Myb domain
PfamPF002491.3E-134386IPR001005SANT/Myb domain
CDDcd001672.60E-94588No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MVEDLSEGYK SITGINNHMD DQITPCEDYA LKSRKPYTIT KQREKWTQDE HKKFLEALKL  60
YGRAWAQIEE HVGNKTAIQI RSHAQKFFSK VVRESSDIDR TTVDNIEIPP PRPKRKPANP  120
YPRNVHIP
Functional Description ? help Back to Top
Source Description
UniProtMorning-phased transcription factor integrating the circadian clock and auxin pathways. Binds to the evening element (EE) of promoters. Does not act within the central clock, but regulates free auxin levels in a time-of-day specific manner. Positively regulates the expression of YUC8 during the day, but has no effect during the night. Negative regulator of freezing tolerance. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Down-regulated and strongly decreased amplitude of circadian oscillation upon cold treatment. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021999531.17e-56protein REVEILLE 1-like
SwissprotF4KGY67e-39RVE1_ARATH; Protein REVEILLE 1
TrEMBLA0A2U1NUZ21e-87A0A2U1NUZ2_ARTAN; Myb domain, Homeodomain-like protein
STRINGSolyc02g036370.2.13e-42(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37260.13e-36MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Xu G, et al.
    REVEILLE1 promotes NADPH: protochlorophyllide oxidoreductase A expression and seedling greening in Arabidopsis.
    Photosyn. Res., 2015. 126(2-3): p. 331-40
    [PMID:25910753]
  3. Jiang Z,Xu G,Jing Y,Tang W,Lin R
    Phytochrome B and REVEILLE1/2-mediated signalling controls seed dormancy and germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 12377
    [PMID:27506149]