PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan018076
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family VOZ
Protein Properties Length: 315aa    MW: 35273.9 Da    PI: 8.1911
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-109538PU_refplantGDBView CDS
gnl|UG|Aan#S41939310PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ403.16e-124662901217
        VOZ   1 pppsaflgpkcalwdctrpaqg........sewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwna 92 
                pppsaflgpkcalwdc+rpaqg        + w+ dycss+ha++a neg  g+tpv+rpkgi+lkd+llfaalsak+qgk+vg+pecegaatakspwna
  Aan018076  66 PPPSAFLGPKCALWDCPRPAQGwcaesrpvQGWFPDYCSSLHAAIAQNEGRFGMTPVIRPKGIELKDTLLFAALSAKTQGKDVGVPECEGAATAKSPWNA 165
                89*******************9554444434699****************************************************************** PP

        VOZ  93 aelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvde 192
                +elfdls++egetirewlffdkprrafesgnrkqrslpdy+grgwhesrkqv++e g lkrsyymdpqp++ +ewhlyeyei+++da+alyrlelklvd+
  Aan018076 166 PELFDLSVFEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVINESGWLKRSYYMDPQPMKFLEWHLYEYEISKCDACALYRLELKLVDG 265
                **************************************************************************************************** PP

        VOZ 193 kksakgkvskdsladlqkklgrlta 217
                kks+kgk+++ s+adlqk++ rlta
  Aan018076 266 KKSPKGKIANVSVADLQKQMRRLTA 290
                ***********************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
IDQCKGSPSG VNNIGAHNIG VANQLDYFSF DLPQDFEQNF FTGFNGMGQE DASLNQMTGY  60
LPTISPPPSA FLGPKCALWD CPRPAQGWCA ESRPVQGWFP DYCSSLHAAI AQNEGRFGMT  120
PVIRPKGIEL KDTLLFAALS AKTQGKDVGV PECEGAATAK SPWNAPELFD LSVFEGETIR  180
EWLFFDKPRR AFESGNRKQR SLPDYNGRGW HESRKQVINE SGWLKRSYYM DPQPMKFLEW  240
HLYEYEISKC DACALYRLEL KLVDGKKSPK GKIANVSVAD LQKQMRRLTA EFPLDNNTKR  300
SVKGRGKASV KDNSG
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023746822.10.0transcription factor VOZ1
RefseqXP_023746823.10.0transcription factor VOZ1
SwissprotQ9SGQ01e-143VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A2U1KCY60.0A0A2U1KCY6_ARTAN; Vascular plant one zinc finger protein
TrEMBLA0A2U1NT530.0A0A2U1NT53_ARTAN; Vascular plant one zinc finger protein
STRINGVIT_10s0003g00500.t011e-164(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-145vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]