PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan017714
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 295aa    MW: 32234.2 Da    PI: 9.751
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-46012PU_refplantGDBView CDS
gnl|UG|Aan#S55197162PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.14.9e-14118163247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++W+++E+ +++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
        Aan017714 118 LPWSEDEHRRFLTGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 163
                      69*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.104.7E-4320IPR001878Zinc finger, CCHC-type
PROSITE profilePS501588.565320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.297112168IPR017930Myb domain
SuperFamilySSF466894.34E-17113169IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-18115167IPR006447Myb domain, plants
SMARTSM007174.8E-10116166IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-10118162IPR009057Homeodomain-like
CDDcd001674.34E-9119164No hitNo description
PfamPF002493.3E-11119163IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGRKCSHCGN IGHNSRTCTS YNRGNVNSTV LVGGGGGGGL RLFGVQLDSP HSMVMKKCLS  60
MDCFPSSSPL PASASHSPTS SLSSSRISLN DLNSDKNMSI GYLSDGLIAR AQERKKGLPW  120
SEDEHRRFLT GLEKLGKGDW RGISRNFVTT RTPTQVASHA QKYFLRQASL FKKKRRSSLF  180
DLVRGNNNKN ALQNQENSCI VSQTSSFEEE QQDHNDKLSF IEFNSLKQEN VYYNPLVKSY  240
QASSICSQIH DSPSGTIGSK SGTLDLELTL AAPKPIDPNK SSTTSLQLGP IISVI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171175KKKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Aan.186980.0leaf
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021996544.11e-158transcription factor KUA1-like
TrEMBLA0A2U1NIA10.0A0A2U1NIA1_ARTAN; Zinc finger, CCHC-type, Myb domain, Homeodomain-like protein
STRINGEOY304926e-82(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.11e-48MYB_related family protein