PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan017619
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 266aa    MW: 29857.7 Da    PI: 9.7644
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-84989PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.46.8e-132569147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r++WT  E++++++a +++  + Wk+I + +g  +t+ q++s+ qky
        Aan017619 25 RQNWTDIEHDKFLEALQLFDRD-WKKIEAFVG-SKTAIQIRSHAQKY 69
                     89******************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-161975IPR009057Homeodomain-like
PROSITE profilePS5129415.0872074IPR017930Myb domain
TIGRFAMsTIGR015573.9E-172372IPR006447Myb domain, plants
SMARTSM007172.8E-102472IPR001005SANT/Myb domain
PfamPF002492.5E-102569IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-62569IPR009057Homeodomain-like
CDDcd001675.26E-82770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MDSNSNGNSN VKKRVRKPYT ITKSRQNWTD IEHDKFLEAL QLFDRDWKKI EAFVGSKTAI  60
QIRSHAQKYF LKVQKTGTNE HVPPPRPKRK AAHPYPLKAK NDVTNVGATQ QSSSDLIKHE  120
NTMPTDSYMW PIAQPDVGAQ DDAILHNSCS SSIDSGPGVW QAGETNNHQQ VKHTMAGRVM  180
PDFPNVYRFI GGVFDPNESN HLQKLKMMDP VDVETVVLLM KNLCANLKSP QFEDYRKLFS  240
SYDPGTGKVA SNGSFQALPR NAITSS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024987309.11e-136protein REVEILLE 6 isoform X2
SwissprotQ8H0W35e-86RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A2U1NHP61e-167A0A2U1NHP6_ARTAN; Homeodomain-like protein
STRINGXP_010261344.12e-94(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.22e-74MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]