PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan016756
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family SBP
Protein Properties Length: 205aa    MW: 23449.6 Da    PI: 8.7578
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-39201PU_refplantGDBView CDS
gnl|UG|Aan#S41941833PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.51.1e-39115189276
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                Cqv+gC++ l ++k+yh+rhkvCe hsk+++v+v+g+ qrfCqqCsrfh l+efD++krsCr+rLa+hnerrrk 
  Aan016756 115 CQVHGCSKSLVSCKDYHKRHKVCELHSKTAKVIVNGILQRFCQQCSRFHLLNEFDDGKRSCRKRLADHNERRRKL 189
                *************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.3E-31110176IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.804112189IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.24E-36113191IPR004333Transcription factor, SBP-box
PfamPF031104.4E-30115188IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MESWTFDSAS NMDFMSQNAI QGLEEMCFPQ VVGNSLLNPV MVANHNAFSE DHDMSFKLSN  60
SVVESDYKDY SGLFDLNLEK NVHQENSKVT NSPFEVSLPS KQTRMAGSVS RSLFCQVHGC  120
SKSLVSCKDY HKRHKVCELH SKTAKVIVNG ILQRFCQQCS RFHLLNEFDD GKRSCRKRLA  180
DHNERRRKLH VGRNGRLLPS YSINK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-281141881084squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024969784.13e-68squamosa promoter-binding-like protein 6
TrEMBLA0A2U1L8451e-150A0A2U1L845_ARTAN; SBP-like protein
STRINGEOY221293e-54(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-43SBP family protein