PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan016735
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 904aa    MW: 101191 Da    PI: 9.2341
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-667160997PU_refplantGDBView CDS
gnl|UG|Aan#S41893253PU_unrefUnigeneView CDS
gnl|UG|Aan#S55199951PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.6e-16592637148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
        Aan016735 592 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 637
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007430.0762086IPR014002Agenet domain, plant type
PfamPF056411.5E-142591IPR008395Agenet-like domain
SMARTSM007431.2E-5111169IPR014002Agenet domain, plant type
SuperFamilySSF466894.85E-18577646IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-5578599IPR009057Homeodomain-like
PROSITE profilePS5129425.891587641IPR017930Myb domain
SMARTSM007171.2E-16591639IPR001005SANT/Myb domain
PfamPF002491.4E-15592637IPR001005SANT/Myb domain
CDDcd001677.36E-11594637No hitNo description
Gene3DG3DSA:1.10.10.601.3E-21600638IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 904 aa     Download sequence    Send to blast
XARQSVGQAH PKASTGLKEN IIEEGCLVEV RKDGDTYDGA WFGANVLSVK DGKALVCYTD  60
IQSDEGSGQL KEWVPLEVGA AEVPKIRSPH PVTTRRLEGT RKRSRTTSTD YVWSSGDLVD  120
VWMQDRWREG VITEINKMDV TSLTVNFPAQ GVTSLVRSWF VRPTLVWKDG KWVDSHTSEK  180
HFSSQEDRPQ EKRLKLGSPI VESKTNKTSS ENIDLVDPQK QEEPKTLSLS THESVFNIGT  240
IKDNKKVTAQ RTIRSGLQKE GPRVIFGVPK PGKKQKFMDI GSSLANKNNR SHDSVKFTKY  300
LIPQAPGSRG WKNSSRDPKE KQATEIKPRM MSRKPPVPSR SFTSSKSTIV DTNTINETNP  360
DCVIDGEKQS GHQNTDIEDE PRHEDLISSL ANSQPPKGAS TSSTKSDRSK KRKFVPTVEK  420
LAKIEKSLPE VVETRRSNRX NSADVKVIRR VAKFYDHLKD TSLFTFNSKK PQQIDSKRKC  480
QQCVKGACVH MGYGHXNLDG GSIQELAYVC IIKXGKQIKL GKANLILSGG FSXVEESFSF  540
CRRRSFMIFC LLLEIFNQVY SIVRLLYMDV FLIKLLRCWL RWTNYLRPDI KRGKFSLQEE  600
QTIIQLHALL GNRWSAIATH LPKRTDNEIK NYWNTHLKKR LTKMGIDPVS HKPKNETLLC  660
NDGQSKSVAN LSHMAQWESA RLEAEARLAK QSKLRCTSLV EKQMGSTESS STGTPAKVLA  720
PNRCLDILNA WNRVWGTKHN DVGEGNGNED LQSPTSTLST TGNEESSTNL IELVGGNSSG  780
SCDNGTTGDQ ECEEEWEYKD ENRTESSIHD FNGISLASID NNNKNGNGHM PSGNFLESFT  840
DLLLSKSGTS NNPNTQGGGN SNTPLEPNGV NNNNNNTCYE ENNKNYWNNI LNLVNSSLQD  900
PPLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-1357764144108B-MYB
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Aan.15360.0leaf
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.16e-62myb domain protein 16