PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan016169
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family TCP
Protein Properties Length: 257aa    MW: 26993.1 Da    PI: 9.9756
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-130713PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP123.81.9e-3822115295
        TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaa 95 
                ++kk + +++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as+++ +  + s++nss+++a  ++a
  Aan016169  22 TVKKPPAKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFSTVSVAVRSNNNSSITAALDQKA 115
                689******************************************************************9986666666666566653333322 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136927.8922882IPR017887Transcription factor TCP subgroup
PfamPF036341.3E-3328125IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MSTDGTTNGV PISSQPGNGV LTVKKPPAKD RHSKVDGRGR RIRMPIICAA RVFQLTRELG  60
HKSDGQTIEW LLRQAEPSII AATGTGTTPA SFSTVSVAVR SNNNSSITAA LDQKAAPPVG  120
HHHHMLSPAP FLLGKRLRAD DEIDKDDGQG GNHMGQAVAV SGGGGGGRGG FWALPARSDF  180
GQVWSFAAAP QDMNSMAAAQ QGRFYQQQQQ QQQVAMGEAS AARVGNYLPI TQGHLNLLAS  240
LQGPPQQSSG GGKDDNE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023736444.11e-120transcription factor TCP7-like
SwissprotQ9FMX24e-84TCP7_ARATH; Transcription factor TCP7
TrEMBLA0A2J6K9I81e-118A0A2J6K9I8_LACSA; Uncharacterized protein
STRINGSolyc04g009180.1.13e-98(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.13e-62TCP family protein