PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan015977
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 228aa    MW: 25986.7 Da    PI: 5.0865
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-91979PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65e-172166148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++++eE+e +++++++lG++ W+ Ia++++ gRt++++k+ w+++l
        Aan015977 21 RGNFSKEEEETIIHLHEKLGNR-WSVIAAKLP-GRTDNEIKNVWHTHL 66
                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.42E-21376IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-9426IPR009057Homeodomain-like
PROSITE profilePS5129425.7471670IPR017930Myb domain
SMARTSM007174.1E-152068IPR001005SANT/Myb domain
PfamPF002491.3E-152166IPR001005SANT/Myb domain
CDDcd001676.17E-112366No hitNo description
Gene3DG3DSA:1.10.10.604.0E-232770IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
RVSRKSCRLR WTNYLRPDIK RGNFSKEEEE TIIHLHEKLG NRWSVIAAKL PGRTDNEIKN  60
VWHTHLKKRL ESHQTTTEVS KKRNTKSKCA SKATSHEEPI VSQCLVQRED IDISTDKKRS  120
TSNQPSSSES SSVTEATDSS NVARLEEIDQ ETFLDESFWS ETLSGEADDI VESNAITNVS  180
LVEFPNTPST IIGNGDNKGS YASYDTNGMD LWYDIFTRME ELPELPEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A2e-1638336121MYB3
3zqc_D2e-1638336121MYB3
3zqc_G2e-1638336121MYB3
3zqc_J2e-1638336121MYB3
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers (PubMed:17015446, PubMed:19161942). Expressed in stomatal guard cells (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269|PubMed:19161942}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022002601.11e-101transcription factor MYB30-like
SwissprotQ9LTC42e-47MYB15_ARATH; Transcription factor MYB15
TrEMBLA0A2U1M4Y41e-151A0A2U1M4Y4_ARTAN; Myb domain protein 15
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.19e-46myb domain protein 15
Publications ? help Back to Top
  1. Schnaubelt D, et al.
    Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana.
    Plant Cell Environ., 2015. 38(2): p. 266-79
    [PMID:24329757]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Ma X, et al.
    CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana.
    Plant Mol. Biol., 2015. 88(3): p. 287-99
    [PMID:25948280]
  4. Kim SH, et al.
    Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis.
    Nucleic Acids Res., 2017. 45(11): p. 6613-6627
    [PMID:28510716]
  5. Chezem WR,Memon A,Li FS,Weng JK,Clay NK
    SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis.
    Plant Cell, 2017. 29(8): p. 1907-1926
    [PMID:28733420]
  6. Pal S, et al.
    TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation.
    Plant Physiol., 2017. 175(2): p. 916-926
    [PMID:28827455]