PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan015836
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 270aa    MW: 30034.5 Da    PI: 6.8075
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Aan#S55186848PU_refUnigeneView CDS
PUT-183a-Artemisia_annua-124781PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.76.2e-143377147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT eE++++++a +++  + Wk+I   +g  +t  q++s+ qky
        Aan015836 33 RESWTDEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 77
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-172783IPR009057Homeodomain-like
PROSITE profilePS5129415.8972882IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-73183IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-183180IPR006447Myb domain, plants
SMARTSM007172.6E-113280IPR001005SANT/Myb domain
PfamPF002492.1E-113377IPR001005SANT/Myb domain
CDDcd001674.71E-93578No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
XHTFYPTIQN NTSMGDSSSG KKVRKPYTIT KSRESWTDEE HDKFLEALQL FDRDWKKIED  60
FVGSKTVIQI RSHAQKYFLK VQKNGSIAHV PPPRPKRKAT HPYPQKAPKN VLLPLQASMG  120
YPSSLSGLAQ GYSPWDDTSL FISQSGEIMP SQDEYELHGF EGMHASDTGS KGAGKISNIS  180
SSGIGSSSRE MPTSEVSNPG EQASIPHGIP DFSEVYSFIG SVFDPESKGH VQKLKEMDPI  240
NFETVLLLMR NLTVNLSNPE FEPMVIMSFS
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:21474993, ECO:0000269|PubMed:21483796, ECO:0000269|PubMed:23638299}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:22902701, ECO:0000269|PubMed:23638299}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024981183.11e-159protein REVEILLE 8-like isoform X5
SwissprotQ8RWU31e-119RVE8_ARATH; Protein REVEILLE 8
TrEMBLA0A2U1MN411e-173A0A2U1MN41_ARTAN; LHY/CCA1-like 1
STRINGSolyc10g084370.1.11e-138(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.11e-110MYB_related family protein
Publications ? help Back to Top
  1. Manfield IW, et al.
    Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis.
    Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9
    [PMID:16845059]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Fogelmark K,Troein C
    Rethinking transcriptional activation in the Arabidopsis circadian clock.
    PLoS Comput. Biol., 2014. 10(7): p. e1003705
    [PMID:25033214]
  4. Xing H, et al.
    LNK1 and LNK2 recruitment to the evening element require morning expressed circadian related MYB-like transcription factors.
    Plant Signal Behav, 2015. 10(3): p. e1010888
    [PMID:25848708]
  5. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]