PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan015630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 562aa    MW: 61612.7 Da    PI: 5.5785
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-64557PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.49.1e-152468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT++E+  +++a k++G   W +I +++g ++t+ q++s+ qk+
        Aan015630 24 RERWTEDEHNSFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.44E-161874IPR009057Homeodomain-like
PROSITE profilePS5129418.2351973IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-72170IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-162271IPR006447Myb domain, plants
SMARTSM007172.0E-112371IPR001005SANT/Myb domain
PfamPF002493.0E-122467IPR001005SANT/Myb domain
CDDcd001671.32E-82669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MDSYSSGEKH NIKTRKPYTI TKQRERWTED EHNSFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KLEKEAIAKG VPIKQALDIE IPPPRPKRKP NYPYPRKTGP KDPQVAEKDG  120
KQETLISSLQ SGIQILDLEK NPLPQTTCHE EELGNETNEE HGTGTEGPSL SHEGPCASSD  180
NENSAPQAFK EFIPVLEKPI NQDETNGSFT SIETRKHQKL DKDGINYTTV TSNTSLYEGR  240
YPDKLSQPVL SLNDIRGVQN YPRHVPVQVI DGNQGKDTVP TETSFLESTL TKSGEVHDIV  300
NKAASATTSV HQNNASSYPT FHPLFTPFSN NQENHRSFLH VSSTVSSLIV SSLLQNPAAH  360
AAASFAATFW HPEASSGDSL SRDHPEPPSM AAIAAATVAA ATAWWAAHGL LPVCTPFYPG  420
YATSPYSCGT PTDANQERVA NNGTSEVVLQ EEKTEAEKTQ GLPKGSPDQS SSDDTDGKLN  480
TELSPDDTAP VAEVHDSTTA NIRKQVDRSS CGSNTTSSSE IETDALEKHG KEKEEAKVSD  540
VNLSCNDTMF RRSRGIINPN ES
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Aan.60810.0trichome
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024996248.10.0protein LHY
RefseqXP_024996249.10.0protein LHY
RefseqXP_024996250.10.0protein LHY
TrEMBLA0A2U1NBF70.0A0A2U1NBF7_ARTAN; Late elongated hypocotyl
STRINGVIT_15s0048g02410.t011e-138(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.31e-57MYB_related family protein