PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan014963
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family BBR-BPC
Protein Properties Length: 308aa    MW: 34770 Da    PI: 9.229
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-135529PU_refplantGDBView CDS
gnl|UG|Aan#S55101143PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind353.54.5e-10813081301
  GAGA_bind   1 mdddgsrernkg.yyepa.aslkenl..glqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla.... 92 
                mdd+g++ r+ g + +p+ + l +++   +q+m+++aerda+i+ernla+sekk a+aerd+a+lqrd+a+aern a++erdn++++l+++en+++    
  Aan014963   1 MDDNGHH-RENGrQKQPQgQWLMQHQpsMKQIMTIMAERDAAIQERNLAMSEKKTALAERDIALLQRDSAIAERNSAIMERDNAIATLQYRENNSMsnsn 99 
                8898885.6666344444544444431145*************************************************************999878999 PP

  GAGA_bind  93 ....salpvgvqvlsgtksidslqqlsepqle.dsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaders 187
                    s++p+g+q+++++k++++ qq  +++ + + + +++e+ k+ +++  ++++ +   +++kk++r++k k +  +  +k   +++++   +++  + 
  Aan014963 100 nntsSSCPPGCQISRNVKHVHHPQQYLQEDANlPASPPAPEQAKSRKTKRPKETKAI---TTTKKTSRSRKVKLECDD-LNKVLYDDTHDW-DSGDGGSN 194
                999999******************943322220222233444433333322222222...222322333333333332.233222222222.22223569 PP

  GAGA_bind 188 kaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkd 287
                k+e+k++dl+ln+v++D++t+P+PvCsCtG+ r CYkWGnGGWqS+CCttt+SvyPLP  +++r+aR++grKmS+++f+kl+++L++eG+dlsnpvDLk+
  Aan014963 195 KQEWKDQDLGLNQVTYDDTTMPIPVCSCTGVFRPCYKWGNGGWQSSCCTTTLSVYPLPSLPNKRHARVGGRKMSGSVFNKLINRLSSEGHDLSNPVDLKE 294
                **************************************************************************************************** PP

  GAGA_bind 288 hWAkHGtnkfvtir 301
                hWAkHGtn+++ti+
  Aan014963 295 HWAKHGTNRYITIK 308
                *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062171.7E-951308IPR010409GAGA-binding transcriptional activator
SMARTSM012261.8E-1481308IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MDDNGHHREN GRQKQPQGQW LMQHQPSMKQ IMTIMAERDA AIQERNLAMS EKKTALAERD  60
IALLQRDSAI AERNSAIMER DNAIATLQYR ENNSMSNSNN NTSSSCPPGC QISRNVKHVH  120
HPQQYLQEDA NLPASPPAPE QAKSRKTKRP KETKAITTTK KTSRSRKVKL ECDDLNKVLY  180
DDTHDWDSGD GGSNKQEWKD QDLGLNQVTY DDTTMPIPVC SCTGVFRPCY KWGNGGWQSS  240
CCTTTLSVYP LPSLPNKRHA RVGGRKMSGS VFNKLINRLS SEGHDLSNPV DLKEHWAKHG  300
TNRYITIK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083484.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083485.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083486.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083487.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083488.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083489.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083490.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083491.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083492.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083493.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083494.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
SwissprotQ8L9991e-140BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLH1ZN701e-165H1ZN70_CICIN; GAGA-binding transcriptional activator
STRINGGLYMA04G02860.11e-156(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-130basic pentacysteine 6