PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan014446
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family BBR-BPC
Protein Properties Length: 298aa    MW: 33208.8 Da    PI: 10.2794
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-479160996PU_refplantGDBView CDS
gnl|UG|Aan#S41936556PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind308.91.7e-9412981301
  GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssia.erdaki....rernlalsekkaav..aerd..............maflqrdkalaernkalverdn 79 
                mdddg + rn+gyyep  s+ke+lglqlms +   rd+k+    re+ + + ++++++  +                 m++ +rd +++   +++++  n
  Aan014446   1 MDDDGLNIRNWGYYEPP-SFKEHLGLQLMSPMIdHRDTKPflspREHPI-MVNPNGVMpyH--HnhlrnsvvnesplpMQY-MRDGWIQRDRHHHMHPGN 95 
                9****988********9.***********987758****9999777666.77777766422..224677889999999999.999999984444444433 PP

  GAGA_bind  80 kllalllvenslasalpvgvqvlsgtksidslqqlse.....pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkkseks 174
                +   l++               +sg++s+++++ql+        +edsav             +    +  +  k++++   ++pk+++akk++k+s+ +
  Aan014446  96 NNYPLIH--------------DSSGSQSMHMMHQLDPsknhgMMMEDSAVSGGGD------SGSGGSGSGVQL-KRRSGPAVANPKQPRAKKPRKTSSIP 174
                3333333..............2334444444444211000113333333331111......112222233333.33346678999**********99999 PP

  GAGA_bind 175 kkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaa 274
                k++ ++++   rsk+ k+s+d+v+ng+++D+s++P+PvCsCtG+++qCY+WG+GGWqSaCCtttiS+yPLP+stkrrgaRiagrKmSqgafkk+LekLa+
  Aan014446 175 KENGNPSG---RSKTVKRSMDVVINGIDMDISGIPIPVCSCTGVQQQCYRWGSGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAS 271
                88888877...79*************************************************************************************** PP

  GAGA_bind 275 eGydlsnpvDLkdhWAkHGtnkfvtir 301
                e y+++n++DL+ hWAkHGtnkfvtir
  Aan014446 272 ESYNFANAIDLRLHWAKHGTNKFVTIR 298
                **************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.8E-1471298IPR010409GAGA-binding transcriptional activator
PfamPF062173.2E-1011298IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MDDDGLNIRN WGYYEPPSFK EHLGLQLMSP MIDHRDTKPF LSPREHPIMV NPNGVMPYHH  60
NHLRNSVVNE SPLPMQYMRD GWIQRDRHHH MHPGNNNYPL IHDSSGSQSM HMMHQLDPSK  120
NHGMMMEDSA VSGGGDSGSG GSGSGVQLKR RSGPAVANPK QPRAKKPRKT SSIPKENGNP  180
SGRSKTVKRS MDVVINGIDM DISGIPIPVC SCTGVQQQCY RWGSGGWQSA CCTTTISMYP  240
LPMSTKRRGA RIAGRKMSQG AFKKVLEKLA SESYNFANAI DLRLHWAKHG TNKFVTIR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070518.11e-118PREDICTED: protein BASIC PENTACYSTEINE1-like
SwissprotQ9SKD02e-90BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLH1ZN690.0H1ZN69_ARTAN; GAGA-binding transcriptional activator
STRINGPGSC0003DMT4000757031e-116(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.23e-86basic pentacysteine1