PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan014338
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family WOX
Protein Properties Length: 255aa    MW: 28586.6 Da    PI: 6.3998
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-595PU_refplantGDBView CDS
gnl|UG|Aan#S41958427PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.25e-2282142257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                r+R+t+t+ ql++Le+lF + n +ps+++++e++++l    +++e++V++WFqNrRa+ k+
  Aan014338  82 RQRWTPTPVQLQILERLFDQgNGTPSKQKIKEITSELsqhgQISETNVYNWFQNRRARSKR 142
                89*****************99**************************************97 PP

2Wus_type_Homeobox101.94.6e-3382144365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        r+RWtPtp Q++iLe+l+++G  tP+k++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
          Aan014338  82 RQRWTPTPVQLQILERLFDQGNGTPSKQKIKEITSELSQHGQISETNVYNWFQNRRARSKRKQ 144
                        79***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.19278143IPR001356Homeobox domain
SuperFamilySSF466892.65E-1978146IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-1880147IPR009057Homeodomain-like
SMARTSM003892.6E-1580147IPR001356Homeobox domain
CDDcd000864.77E-1582144No hitNo description
PfamPF000467.9E-2082142IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MEHDDVNNNN NNNNNNGMFV KVMTDEQMEV LRKQIAIYAT ICEQLVDLHK SLTSHHDLTG  60
VRLGNLYSDP LVTSGGHKFS GRQRWTPTPV QLQILERLFD QGNGTPSKQK IKEITSELSQ  120
HGQISETNVY NWFQNRRARS KRKQQVSAPN NGESEVETEV ESPKPQQNSA STADDNMCFQ  180
NPNVSSGITS ADQRTKKVEP IFPSDASSKP AGNVGQMSYY GSMLANPRMD HIIGKMEVSG  240
GYQPYMQNDE YNMTG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135143RRARSKRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024974243.11e-159WUSCHEL-related homeobox 8-like isoform X2
SwissprotQ5QMM32e-83WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLA0A2U1QHS31e-171A0A2U1QHS3_ARTAN; Homeodomain-containing protein
STRINGSolyc02g082670.2.11e-123(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.15e-79WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]