PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan014257
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 204aa    MW: 22214.8 Da    PI: 7.4406
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-674160990PU_refplantGDBView CDS
gnl|UG|Aan#S56530287PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.9e-181458147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg++T++Ed+l+v +++ lG++ W+ Ia++++ gRt++++k++w+++
        Aan014257 14 RGNFTPQEDQLIVSLHAVLGNK-WSMIASRLP-GRTDNEIKNYWNTH 58
                     89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-6220IPR009057Homeodomain-like
SuperFamilySSF466899.71E-20367IPR009057Homeodomain-like
PROSITE profilePS5129427.561963IPR017930Myb domain
SMARTSM007172.7E-161361IPR001005SANT/Myb domain
PfamPF002491.2E-151458IPR001005SANT/Myb domain
CDDcd001674.55E-131659No hitNo description
Gene3DG3DSA:1.10.10.604.2E-242160IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
XLRWINYLRP DLKRGNFTPQ EDQLIVSLHA VLGNKWSMIA SRLPGRTDNE IKNYWNTHIK  60
RKLVANNSTT TTTTNAVKTI EETPVVPQEH SAQVVESSNS GVGGNGSTTS GLSTEECTPV  120
VSIRQPEINL ELSIGLPMVS DQKMVTVAAV AALSPPVSAF SLYNKKIVDG CGGAVSVGND  180
NGFLCNEDNS ISFGRFDFLS SRWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1836348108B-MYB
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, flower buds, and siliques. {ECO:0000269|PubMed:9839469}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By ethylene, asbscisic acid (ABA), auxin (IAA), and Pseudomonas syringae pv. phaseolica. {ECO:0000269|PubMed:9839469}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024983269.13e-88transcription factor MYB8-like
SwissprotQ388515e-41MYB6_ARATH; Transcription repressor MYB6
TrEMBLA0A2U1QKA41e-140A0A2U1QKA4_ARTAN; Myb domain protein 6
STRINGfgenesh2_kg.6__2929__AT4G09460.14e-41(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.12e-37myb domain protein 6