PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan013948
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 238aa    MW: 26467.6 Da    PI: 10.5005
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Aan#S41961800PU_refUnigeneView CDS
PUT-183a-Artemisia_annua-86026PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.94.8e-1394138347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + +  G+g+W+ I+r + k+Rt+ q+ s+ qky
        Aan013948  94 PWTEEEHRLFLIGLQNVGKGDWRGISRNFVKTRTPTQVASHAQKY 138
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.28587143IPR017930Myb domain
SuperFamilySSF466896.28E-1789143IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-1690141IPR006447Myb domain, plants
SMARTSM007173.7E-891141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-1193138IPR009057Homeodomain-like
PfamPF002494.6E-1094138IPR001005SANT/Myb domain
CDDcd001676.10E-894139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MAFEPGKWPD STNGDGELSV NNNGNRGKSI MLFGVRLMEG GGSGSGGFRK SVSMNNLAQF  60
DEQPPDSNPD ATGYASDDVV HPSARSRERK RGVPWTEEEH RLFLIGLQNV GKGDWRGISR  120
NFVKTRTPTQ VASHAQKYFL RRTNHNRRRR RSSLFDITTD TCMTSSMDDD QKLPSNLKYE  180
PEKFPISSFP SNRLESLTLG RAPTAKQVTK TLGNQMPPIP IPPSNKMAKL NLSATNDN
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Accumulates during leaf expansion. First observed at the tip of the leaves 12 days after sowing (DAS). At 14 DAS, expressed throughout the leaf blade to fade out thereafter in a basipetal manner. In mature leaves, detected in vascular tissue, especially in companion cells (PubMed:24806884). Accumulates to higher levels in old rosette leaves than in young rosette and cauline leaves (PubMed:25920996). {ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}.
UniprotTISSUE SPECIFICITY: Expressed ubiquitously, except in hypocotyls, root tips and lateral root primordia. {ECO:0000269|PubMed:25920996}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996). {ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by CdCl(2) (PubMed:16463103). Accumulates in the dark (PubMed:23888064, PubMed:25920996). Diurnal expression pattern with maximal levels in the morning (at protein level). Specifically induced during leaf expansion (PubMed:24806884). Expressed in old and dark-treated leaves (PubMed:25920996). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023761314.11e-103transcription factor MYB1R1-like
SwissprotQ9LVS04e-48KUA1_ARATH; Transcription factor KUA1
TrEMBLA0A2U1PI701e-176A0A2U1PI70_ARTAN; Myb domain, Homeodomain-like protein
STRINGEOY002779e-75(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.25e-59MYB_related family protein
Publications ? help Back to Top
  1. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]