PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan012518
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family TCP
Protein Properties Length: 89aa    MW: 9810.14 Da    PI: 10.807
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Aan#S55167903PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP52.52e-165789335
        TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdL 35
               + k++++++hTkv+gR+RR+R++a+caar+F+L
  Aan012518 57 APKRSTKDRHTKVDGRGRRIRMPATCAARVFQL 89
               6799****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.6E-126189IPR005333Transcription factor, TCP
PROSITE profilePS5136915.1636289IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MEPTNNHYQQ QQQALPMVAP SATSPPVDPS LAIATRSEEP IKENNQQVAT VTPPPPAPKR  60
STKDRHTKVD GRGRRIRMPA TCAARVFQL
Functional Description ? help Back to Top
Source Description
UniProtCan specifically bind site II elements in the promoter region of PP438/PNM1. {ECO:0000269|PubMed:21297037}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024980203.11e-21transcription factor TCP8
SwissprotQ9C5184e-15TCP8_ARATH; Transcription factor TCP8
TrEMBLA0A2U1PFL01e-42A0A2U1PFL0_ARTAN; Transcription factor, TCP
STRINGXP_004485466.13e-20(Cicer arietinum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58100.13e-17TCP family protein
Publications ? help Back to Top
  1. Mazur MJ, et al.
    Arabidopsis TCP Transcription Factors Interact with the SUMO Conjugating Machinery in Nuclear Foci.
    Front Plant Sci, 2017. 8: p. 2043
    [PMID:29250092]