PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan011350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 131aa    MW: 14819.4 Da    PI: 9.1617
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Aan#S41966679PU_refUnigeneView CDS
PUT-183a-Artemisia_annua-46399PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.2e-1776121147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+++G+ +W++Ia+++  gR++k+c++rw++ 
        Aan011350  76 RGHWKPVEDAKLKELVALYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 121
                      899*****************************.***********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.66871126IPR017930Myb domain
SuperFamilySSF466893.07E-1674129IPR009057Homeodomain-like
SMARTSM007172.4E-1475124IPR001005SANT/Myb domain
PfamPF002491.2E-1676121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2277131IPR009057Homeodomain-like
CDDcd001672.53E-1379120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MYTQYHNYHH HNLASASSSS SSLSNDHSIL RNLHGNDQDH GHGTDEGINL TLKSNIDSHD  60
HNGGIRPCGQ LRTSARGHWK PVEDAKLKEL VALYGPQNWN LIAEKLEGRS GKSCRLRWFN  120
QLDPRINKKA F
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in organ boundaries. {ECO:0000269|PubMed:19542355}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning. Functions in both lateral organ separation and axillary meristem formation. {ECO:0000269|PubMed:19542355}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021998624.12e-42transcription factor MYB105-like
SwissprotQ9SEZ49e-33MY105_ARATH; Transcription factor MYB105
TrEMBLA0A2U1KFX81e-90A0A2U1KFX8_ARTAN; Homeodomain-like protein
STRINGevm.model.supercontig_1.432e-34(Carica papaya)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-34myb domain protein 105
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]