PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan010871
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 146aa    MW: 17185.9 Da    PI: 7.7099
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Aan#S55163098PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.47.6e-095294346
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      WT+eE ++l d+++++  + +  Ia ++++ Rt +++k+r+++
        Aan010871 52 TWTKEETDQLFDLCERFDLR-FVVIADRFPTPRTVEELKNRYYS 94
                     7*******************.*********88**********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162822.2E-322599IPR032563DAMP1, SANT/Myb-like domain
Gene3DG3DSA:1.10.10.601.1E-74697IPR009057Homeodomain-like
SuperFamilySSF466895.06E-848101IPR009057Homeodomain-like
SMARTSM007171.1E-94998IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
XARKDNLELY HWVRVVNGTP PTGDYSFAKY NKSVDVIKYT DEEYEKHLTD STWTKEETDQ  60
LFDLCERFDL RFVVIADRFP TPRTVEELKN RYYSVSRTIL IARAPSPADV SGHPLVKEPY  120
NISHEIDRKR ALSMVLSQTK HQERKX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A2e-2224109493DNA methyltransferase 1-associated protein 1
4iej_A2e-2224109493DNA methyltransferase 1-associated protein 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. {ECO:0000305|Ref.5}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024966509.14e-94SWR1-complex protein 4 isoform X1
RefseqXP_024966511.13e-94SWR1-complex protein 4 isoform X3
SwissprotQ8VZL67e-80SWC4_ARATH; SWR1-complex protein 4
TrEMBLA0A2U1PEC91e-100A0A2U1PEC9_ARTAN; Myb-like transcription factor family protein
STRINGXP_010241543.12e-91(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.13e-82MYB_related family protein
Publications ? help Back to Top
  1. Gómez-Zambrano Á, et al.
    Arabidopsis SWC4 Binds DNA and Recruits the SWR1 Complex to Modulate Histone H2A.Z Deposition at Key Regulatory Genes.
    Mol Plant, 2018. 11(6): p. 815-832
    [PMID:29604400]