PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan010760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family SBP
Protein Properties Length: 149aa    MW: 17162.3 Da    PI: 8.9974
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Aan#S55031563PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.71.9e-3964140177
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                +CqvegC++d++++k+yhrrhkv + h+kap v+++g +qrfCqqCsrfh+lsefD++krsCrrrLa+hnerrrk++
  Aan010760  64 CCQVEGCTTDMTNCKTYHRRHKVRKRHAKAPIVVTNGCQQRFCQQCSRFHDLSEFDDAKRSCRRRLAGHNERRRKSS 140
                6**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.1E-3157126IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.07762139IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.71E-3663143IPR004333Transcription factor, SBP-box
PfamPF031102.3E-2965138IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MAEFEKSLYL SKICQDIIHI VTEQHHQLQE LVADDDDENF GEGRRKKKVL GKRGSGSAGS  60
IQPCCQVEGC TTDMTNCKTY HRRHKVRKRH AKAPIVVTNG CQQRFCQQCS RFHDLSEFDD  120
AKRSCRRRLA GHNERRRKSS YESYGETSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3255138384squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024988508.11e-62squamosa promoter-binding protein 1-like
SwissprotQ387412e-44SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A103XU003e-61A0A103XU00_CYNCS; Squamosa promoter-binding-like protein
STRINGEOY130692e-42(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.23e-19squamosa promoter binding protein-like 4
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]