PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan008483
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 216aa    MW: 24984.5 Da    PI: 10.6299
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Aan#S41963649PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding285e-094587347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT +E+e +  a ++ G++ +++I ++++  +   q++++++ +
        Aan008483 45 AWTRQEEESFFSALHKVGKN-FEKITSRVQ-SKNKDQVRHYYYRL 87
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-104092IPR009057Homeodomain-like
PROSITE profilePS5129313.5614192IPR017884SANT domain
SMARTSM007171.8E-64290IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-64490IPR009057Homeodomain-like
PfamPF002491.1E-74587IPR001005SANT/Myb domain
CDDcd001671.32E-54588No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MEPHVSGHEV SDIPESVFIK DVITSETHHV ASKEPASKKT RQWAAWTRQE EESFFSALHK  60
VGKNFEKITS RVQSKNKDQV RHYYYRLVRR MNKLLGPELA LDARNCKETN AAMLRWWSLL  120
EKQSCKASKL HLKPRRFKIF MENLEHQLLK DRKKNIRKRL IQGENSSLTP SNAVSIQGRA  180
CTQDARIDLV DSQTTQNLNS GKGSSLRRNA NTCLDR
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers, roots and leaves. {ECO:0000269|PubMed:15047893}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024979013.11e-123TSL-kinase interacting protein 1-like isoform X1
RefseqXP_024979019.11e-124TSL-kinase interacting protein 1-like isoform X2
SwissprotQ8LJT86e-77TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLA0A2U1KZN11e-148A0A2U1KZN1_ARTAN; TSL-kinase interacting protein 1
STRINGGorai.009G414900.14e-90(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.13e-79TSL-kinase interacting protein 1