PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan008353
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family SBP
Protein Properties Length: 220aa    MW: 24233.9 Da    PI: 9.3559
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Aan#S41953102PU_refUnigeneView CDS
PUT-183a-Artemisia_annua-13173PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.42.4e-39147219173
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT------ CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerr 73 
                +CqvegC+ dls+ keyhr+hkvCe hsk+p+v+v+g+e+rfCqqCsrfh++sefDeekrsCrrrL++hn+rr
  Aan008353 147 RCQVEGCNLDLSSSKEYHRKHKVCESHSKSPKVIVAGVERRFCQQCSRFHSMSEFDEEKRSCRRRLSDHNARR 219
                6***********************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-33143209IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.137145220IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.66E-36146219IPR004333Transcription factor, SBP-box
PfamPF031101.2E-30148219IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MEWEWENLDM YNSKSIMTPK KMQPAYWGVE EVEAIDGSIS FNVSGVVGGS GGSVSDVGNN  60
SSGKSSISAS TESSMKEGMK GSGYSFVGSV SSGEPFIGLK LGKRTYFENG YAKNNTNKAY  120
SQLAVPASTI STGKKVKSAY QTTPIVRCQV EGCNLDLSSS KEYHRKHKVC ESHSKSPKVI  180
VAGVERRFCQ QCSRFHSMSE FDEEKRSCRR RLSDHNARRX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-281482191182squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed constitutively during plant development, weak increase during flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157 (Probable). Up-regulated by Turnip mosaic virus P1/HC-Pro protein, that acts as an antagonist of miR156. {ECO:0000269|PubMed:12202040, ECO:0000269|PubMed:12586064, ECO:0000305}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024991191.14e-97squamosa promoter-binding-like protein 10 isoform X1
RefseqXP_024991192.12e-97squamosa promoter-binding-like protein 2 isoform X2
SwissprotQ9S8401e-55SPL2_ARATH; Squamosa promoter-binding-like protein 2
TrEMBLA0A2U1LZ651e-157A0A2U1LZ65_ARTAN; SBP-like protein
STRINGXP_010252163.12e-67(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.41e-49squamosa promoter binding protein-like 10