PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan008146
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family SBP
Protein Properties Length: 227aa    MW: 25656.8 Da    PI: 9.9143
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Aan#S55207571PU_refUnigeneView CDS
PUT-183a-Artemisia_annua-46565PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP65.51.1e-201394078
               EEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP 40 qrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
               qrfCqqCsrfh l efDe krsCr+rL++hn+rrrk+++
  Aan008146  1 QRFCQQCSRFHLLGEFDEVKRSCRKRLDGHNRRRRKPRT 39
               8***********************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114119.375137IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.65E-18143IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.102.9E-10124IPR004333Transcription factor, SBP-box
PfamPF031101.5E-13136IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
QRFCQQCSRF HLLGEFDEVK RSCRKRLDGH NRRRRKPRTD SMYLNYGSYL ANHQGTKLLN  60
FGGSPAYTTT FGSSLTWPSE EKFNQKLHVA VEQTTPSTSY ARARERKFPF LLDTDSDQVN  120
HMFSGTTFQH TSASAHLLLE PKGALSLLSN HKIHHVHASE SGPNNLIQPP GTALQFNGSL  180
NQHLNPHLPL RNVTSGHATN HLIGMIHFRA DALLENEAAK VLSFSWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-131364984squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11936KRSCRKRLDGHNRRRRKP
23137RRRRKPR
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021982433.15e-86teosinte glume architecture 1-like
RefseqXP_021982434.15e-86teosinte glume architecture 1-like
SwissprotQ0J0K12e-23SPL18_ORYSJ; Squamosa promoter-binding-like protein 18
TrEMBLA0A2U1N7781e-167A0A2U1N778_ARTAN; SBP-like protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-22SBP family protein